PDB entry 3mtc

View 3mtc on RCSB PDB site
Description: Crystal Structure of INPP5B in complex with phosphatidylinositol 4-phosphate
Deposited on 2010-04-30, released 2010-06-30
The last revision was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.172
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II inositol-1,4,5-trisphosphate 5-phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: Inpp5b
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32019 (1-305)
      • expression tag (0)
      • expression tag (306-309)
  • Heterogens: GOL, MG, PIF, SO4, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mtcA (A:)
    mytyiqnfrffagtynvngqspkeclrlwlsngiqapdvycvgfqeldlskeafffhdtp
    keeewfkavseglhpdakyakvklirlvgimlllyvkqehaayiseveaetvgtgimgrm
    gnkggvairfqfhntsicvvnshlaahieeyerrnqdykdicsrmqfcqpdpslppltis
    nhdvilwlgdlnyrieeldvekvkklieekdfqmlyaydqlkiqvaaktvfegftegelt
    fqptykydtgsddwdtsekcrapawcdrilwkgknitqlsyqshmalktsdhkpvssvfd
    igvrvvahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mtcA (A:)
    mytyiqnfrffagtynvngqspkeclrlwlsngiqapdvycvgfqeldlskeafffhdtp
    keeewfkavseglhpdakyakvklirlvgimlllyvkqehaayiseveaetvgtgimgrm
    gnkggvairfqfhntsicvvnshlaahieeyerrnqdykdicsrmqfcqpdpslppltis
    nhdvilwlgdlnyrieeldvekvkklieekdfqmlyaydqlkiqvaaktvfegftegelt
    fqptykydtgsddwdtsekcrapawcdrilwkgknitqlsyqshmalktsdhkpvssvfd
    igvrvvahhh