PDB entry 3mt1

View 3mt1 on RCSB PDB site
Description: crystal structure of putative carboxynorspermidine decarboxylase protein from sinorhizobium meliloti
Deposited on 2010-04-29, released 2010-06-30
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative carboxynorspermidine decarboxylase protein
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: nspC, RB1551, SM_b21631, SMb21631
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Putative carboxynorspermidine decarboxylase protein
    Species: Sinorhizobium meliloti [TaxId:382]
    Gene: nspC, RB1551, SM_b21631, SMb21631
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mt1A (A:)
    mietpyylidkakltrnmeriahvreksgakallalkcfatwsvfdlmrdymdgttsssl
    fevrlgrerfgkethaysvaygdneidevvshadkiifnsisqlerfadkaagiarglrl
    npqvssssfdladparpfsrlgewdvpkvervmdringfmihnncenkdfglfdrmlgei
    eerfgaliarvdwvslgggihftgddypvdafsarlrafsdrygvqiylepgeasitkst
    tlevtvldtlyngknlaivdssieahmldlliyretakvlpnegshsymicgksclagdv
    fgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgsvrtvreftyady
    eqsls
    

    Sequence, based on observed residues (ATOM records):
    >3mt1A (A:)
    ietpyylidkakltrnmeriahvreksgakallalkcfatwsvfdlmrdymdgttssslf
    evrlgrerfgkethaysvaygdneidevvshadkiifnsisqlerfadkaagiarglrln
    pqrlgewdvpkvervmdringfmihnnnkdfglfdrmlgeieerfgaliarvdwvslggg
    ihftgddypvdafsarlrafsdrygvqiylepgeasitksttlevtvldtlyngknlaiv
    dssieahmldlliyretakvlpnegshsymicgksclagdvfgefrfaeelkvgdrisfq
    daagytmvkknwfngvkmpaiaireldgsvrtvreftyadyeqsls
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mt1B (B:)
    mietpyylidkakltrnmeriahvreksgakallalkcfatwsvfdlmrdymdgttsssl
    fevrlgrerfgkethaysvaygdneidevvshadkiifnsisqlerfadkaagiarglrl
    npqvssssfdladparpfsrlgewdvpkvervmdringfmihnncenkdfglfdrmlgei
    eerfgaliarvdwvslgggihftgddypvdafsarlrafsdrygvqiylepgeasitkst
    tlevtvldtlyngknlaivdssieahmldlliyretakvlpnegshsymicgksclagdv
    fgefrfaeelkvgdrisfqdaagytmvkknwfngvkmpaiaireldgsvrtvreftyady
    eqsls
    

    Sequence, based on observed residues (ATOM records):
    >3mt1B (B:)
    mietpyylidkakltrnmeriahvreksgakallalkcfatwsvfdlmrdymdgttsssl
    fevrlgrerfgkethaysvaygdneidevvshadkiifnsisqlerfadkaagiarglrl
    npqrlgewdvpkvervmdringfmihnncenkdfglfdrmlgeieerfgaliarvdwvsl
    gggihftgddypvdafsarlrafsdrygvqiylepgeasitksttlevtvldtlynknla
    ivdssieahmldlliyretakvlpnegshsymicgksclagdvfgefrfaeelkvgdris
    fqdaagytmvkknwfngvkmpaiaireldgsvrtvreftyadyeqsls