PDB entry 3mt0

View 3mt0 on RCSB PDB site
Description: The crystal structure of a functionally unknown protein PA1789 from Pseudomonas aeruginosa PAO1
Deposited on 2010-04-29, released 2010-05-12
The last revision was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.178
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized protein PA1789
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA1789
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I2V3 (3-289)
      • expression tag (0-2)
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mt0A (A:)
    snamqairsilvviepdqleglalkraqliagvtqshlhllvcekrrdhsaalndlaqel
    reegysvstnqawkdslhqtiiaeqqaegcgliikqhfpdnplkkailtpddwkllrfap
    cpvlmtktarpwtggkilaavdvgnndgehrslhagiishaydiaglakatlhvisahps
    pmlssadptfqlsetiearyreacrtfqaeygfsdeqlhieegpadvliprtaqkldavv
    tvigtvartglsgaligntaevvldtlesdvlvlkpddiiahleelaske
    

    Sequence, based on observed residues (ATOM records):
    >3mt0A (A:)
    snamqairsilvviepdqleglalkraqliagvtqshlhllvcekrrdhsaalndlaqel
    reegysvstnqawkdslhqtiiaeqqaegcgliikqhfpdnplkkailtpddwkllrfap
    cpvlmtktarpwtggkilaavdvgnndgehrslhagiishaydiaglakatlhvisahpt
    fqlsetiearyreacrtfqaeygfsdeqlhieegpadvliprtaqkldavvtvigtvart
    glsgaligntaevvldtlesdvlvlkpddiiahleelaske