PDB entry 3msz

View 3msz on RCSB PDB site
Description: Crystal Structure of Glutaredoxin 1 from Francisella tularensis Complexed with Cacodylate
Class: oxidoreductase
Keywords: alpha-beta sandwich, Center for Structural Genomics of Infectious Diseases, CSGID, OXIDOREDUCTASE
Deposited on 2010-04-29, released 2010-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.175
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaredoxin 1
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: FTT_0533c, grxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NHD0
      • expression tag (2)
    Domains in SCOPe 2.07: d3msza1, d3msza2
  • Chain 'B':
    Compound: Glutaredoxin 1
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: FTT_0533c, grxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NHD0 (3-88)
      • expression tag (2)
    Domains in SCOPe 2.07: d3mszb1, d3mszb2
  • Heterogens: CAC, GSH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mszA (A:)
    snamkvkiytrngcpycvwakqwfeenniafdetiiddyaqrskfydemnqsgkvifpis
    tvpqifiddehiggftelkanadkilnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mszA (A:)
    amkvkiytrngcpycvwakqwfeenniafdetiiddyaqrskfydemnqsgkvifpistv
    pqifiddehiggftelkanadkilnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mszB (B:)
    snamkvkiytrngcpycvwakqwfeenniafdetiiddyaqrskfydemnqsgkvifpis
    tvpqifiddehiggftelkanadkilnkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mszB (B:)
    amkvkiytrngcpycvwakqwfeenniafdetiiddyaqrskfydemnqsgkvifpistv
    pqifiddehiggftelkanadkilnkk