PDB entry 3msy

View 3msy on RCSB PDB site
Description: Crystal Structure of Mandelate racemase/muconate lactonizing enzyme from a Marine actinobacterium
Class: isomerase
Keywords: Enolase, Metal-binding, PSI-II, NYSGXRC., Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, ISOMERASE
Deposited on 2010-04-29, released 2010-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium PHSC20C1 [TaxId:312284]
    Gene: A20C1_08358, AAOB01000002
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3msya1, d3msya2
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium PHSC20C1 [TaxId:312284]
    Gene: A20C1_08358, AAOB01000002
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3msyb1, d3msyb2
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium PHSC20C1 [TaxId:312284]
    Gene: A20C1_08358, AAOB01000002
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3msyc1, d3msyc2
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium PHSC20C1 [TaxId:312284]
    Gene: A20C1_08358, AAOB01000002
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3msyd1, d3msyd2
  • Chain 'E':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium PHSC20C1 [TaxId:312284]
    Gene: A20C1_08358, AAOB01000002
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3msye1, d3msye2
  • Chain 'F':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: marine actinobacterium PHSC20C1 [TaxId:312284]
    Gene: A20C1_08358, AAOB01000002
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3msyf1, d3msyf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3msyA (A:)
    msltitrietipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdi
    driiheelaptligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkal
    kmplwklwggyrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaa
    ritaareaagddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvr
    yqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmgh
    heepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnw
    dyidqyrvskdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3msyA (A:)
    ipmvaplarefrgthrativtrvhtdagiigeaytgdehetmfdidriiheelaptligq
    damaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyrnel
    pmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagddfii
    cidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqtefs
    asgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthllasqp
    hgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3msyB (B:)
    msltitrietipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdi
    driiheelaptligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkal
    kmplwklwggyrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaa
    ritaareaagddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvr
    yqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmgh
    heepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnw
    dyidqyrvskdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3msyB (B:)
    ipmvaplarefrgshthrativtrvhtdagiigeaytgdehetmfdidriiheelaptli
    gqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyrn
    elpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagddf
    iicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqte
    fsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthllas
    qphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3msyC (C:)
    msltitrietipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdi
    driiheelaptligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkal
    kmplwklwggyrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaa
    ritaareaagddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvr
    yqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmgh
    heepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnw
    dyidqyrvskdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3msyC (C:)
    ipmvaplarefrgshthrativtrvhtdagiigeaytgdehetmfdidriiheelaptli
    gqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyrn
    elpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagddf
    iicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqte
    fsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthllas
    qphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqyrv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3msyD (D:)
    msltitrietipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdi
    driiheelaptligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkal
    kmplwklwggyrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaa
    ritaareaagddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvr
    yqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmgh
    heepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnw
    dyidqyrvskdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3msyD (D:)
    ipmvaplarefrgshthrativtrvhtdagiigeaytgdehetmfdidriiheelaptli
    gqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyrn
    elpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagddf
    iicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqte
    fsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthllas
    qphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyid
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3msyE (E:)
    msltitrietipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdi
    driiheelaptligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkal
    kmplwklwggyrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaa
    ritaareaagddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvr
    yqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmgh
    heepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnw
    dyidqyrvskdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3msyE (E:)
    ipmvaplarefrgsthrativtrvhtdagiigeaytgdehetmfdidriiheelaptlig
    qdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyrne
    lpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagddfi
    icidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqtef
    sasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthllasq
    phgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyid
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3msyF (F:)
    msltitrietipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdi
    driiheelaptligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkal
    kmplwklwggyrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaa
    ritaareaagddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvr
    yqgsvpvcagqtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmgh
    heepqvsthllasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnw
    dyidqyrvskdeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3msyF (F:)
    ipmvaplarefrgshthrativtrvhtdagiigeaytgdehetmfdidriiheelaptli
    gqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwggyrn
    elpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaagddf
    iicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqte
    fsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthllas
    qphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyid