PDB entry 3msw

View 3msw on RCSB PDB site
Description: crystal structure of a protein with unknown function (bf3112) from bacteroides fragilis nctc 9343 at 1.90 a resolution
Deposited on 2010-04-29, released 2010-06-09
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF3112
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LAR6 (1-End)
      • leader sequence (0)
  • Heterogens: CL, PGR, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mswA (A:)
    gtnngkqfihndtmeggklvcreiyamndaasgilnpvkmykysydtdqqktvkstyawn
    ifkntwetesrtvisryetetsveysvwnkekgsfdlskkyiyitdnnnqliaqyaykmn
    srtnqwilekdaltpiyeniyattr
    

    Sequence, based on observed residues (ATOM records):
    >3mswA (A:)
    gtnngkqfihndtmeggklvcreiyamndaasgilnpvkmykysydtdqqktvkstyawn
    ifkntwetesrtvisryetetsveysvwnkekgsfdlskkyiyitdnnnqliaqyaykmn
    srtnqwilekdaltpiyen