PDB entry 3msv

View 3msv on RCSB PDB site
Description: The hypoxic regulator of sterol synthesis Nro1 is a nuclear import adaptor
Deposited on 2010-04-29, released 2011-04-20
The last revision was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.207
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear import adaptor, Nro1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPCC4B3.07
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nuclear import adaptor, Nro1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPCC4B3.07
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3msvA (A:)
    migrrpqglraaaslkkqqqlekqkqeasyelsgnsspskengsenvdngemedetmlvy
    teednisqlwglyemsreklenddidasvslvfgtiheadrilrntedistlpkdfhaay
    ssallavselfeiaqkrlketnteesyidaaieraqlgldapgnesrlflalaraylekv
    rvlvwrhdneeslanipvtqlvnpyiekaiqylrplaqdsteyfdaltpdslrplyilss
    ylfqfgdqfseaflldvcsiitalwlksvvdpntpayykliaqeavlnnyttfaeyymdl
    ldnsesnvddlinkasswlnnsvdtwnviytldksperllkladikmdlaqivqdeasqd
    nylkeacnaikeaqgsgvelspdyvefveaysa
    

    Sequence, based on observed residues (ATOM records):
    >3msvA (A:)
    aslkkqqqlekqkqeasyelseednisqlwglyemsreklenddidasvslvfgtihead
    rilrntedistlpkdfhaayssallavselfeiaqkrlketnteesyidaaieraqlgld
    apgnesrlflalaraylekvrvlvwrhdneeslanipvtqlvnpyiekaiqylrplaqds
    teyfdaltpdslrplyilssylfqfgdqfseaflldvcsiitalwlksvvdpntpayykl
    iaqeavlnnyttfaeyymdlldnsesnvddlinkasswlnnsvdtwnviytldksperll
    kladikmdlaqivqdeasqdnylkeacnaikeaqgsgvelspdyvefveays
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3msvB (B:)
    migrrpqglraaaslkkqqqlekqkqeasyelsgnsspskengsenvdngemedetmlvy
    teednisqlwglyemsreklenddidasvslvfgtiheadrilrntedistlpkdfhaay
    ssallavselfeiaqkrlketnteesyidaaieraqlgldapgnesrlflalaraylekv
    rvlvwrhdneeslanipvtqlvnpyiekaiqylrplaqdsteyfdaltpdslrplyilss
    ylfqfgdqfseaflldvcsiitalwlksvvdpntpayykliaqeavlnnyttfaeyymdl
    ldnsesnvddlinkasswlnnsvdtwnviytldksperllkladikmdlaqivqdeasqd
    nylkeacnaikeaqgsgvelspdyvefveaysa
    

    Sequence, based on observed residues (ATOM records):
    >3msvB (B:)
    kkqqqlekqkqeasyelsvyteednisqlwglyemsreklenddidasvslvfgtihead
    rilrntedistlpkdfhaayssallavselfeiaqkrlketnteesyidaaieraqlgld
    apgnesrlflalaraylekvrvlvwrhdneeslanipvtqlvnpyiekaiqylrplaqds
    teyfdaltpdslrplyilssylfqfgdqfseaflldvcsiitalwlksvvdpntpayykl
    iaqeavlnnyttfaeyymdlldnvddlinkasswlnnsvdtwnviytldksperllklad
    ikmdlaqivqdeasqdnylkeacnaikeaqgsgvelspdyvefveays