PDB entry 3msu

View 3msu on RCSB PDB site
Description: Crystal Structure of Citrate Synthase from Francisella tularensis
Class: transferase
Keywords: Helix Bundle, Apha-Beta Fold, CSGID, Center for Structural Genomics of Infectious Diseases, TRANSFERASE
Deposited on 2010-04-29, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-26, with a file datestamp of 2010-05-21.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.162
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citrate synthase
    Species: Francisella tularensis [TaxId:263]
    Gene: FTT_0071c, gltA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NIJ6 (3-426)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3msua1, d3msua2
  • Chain 'B':
    Compound: citrate synthase
    Species: Francisella tularensis [TaxId:263]
    Gene: FTT_0071c, gltA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NIJ6 (3-426)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3msub1, d3msub2
  • Heterogens: OAA, ZN, CL, SO4, ACY, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3msuA (A:)
    snamevmlmskyatlkyadknieielpvyspslgndcidvsslvkhgiftydpgfmstaa
    ceskityidggkgvllhrgypieewtqksnyrtlcyaliygelptdeqvksfrqeiinkm
    pvcehvkaaiaampqhthpmssliagvnvlaaehihngqkesqdevaknivakiatiaam
    ayrhnhgkkflepkmeygyaenflymmfaddesykpdelhikamdtifmlhadheqnast
    stvrlsgstgnspyaaiiagitalwgpahgganeavlkmlseigstenidkyiakakdkd
    dpfrlmgfghrvykntdpratamkknceeilaklghsdnplltvakkleeialqdeffie
    rklfsnvdfysgiilkamgipedmftaifalartsgwisqwiemvndpaqkigrprqlyt
    gatnrnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3msuA (A:)
    namevmlmskyatlkyadknieielpvyspslgndcidvsslvkhgiftydpgfmstaac
    eskityidggkgvllhrgypieewtqksnyrtlcyaliygelptdeqvksfrqeiinkmp
    vcehvkaaiaampqhthpmssliagvnvlaaehihngqkesqdevaknivakiatiaama
    yrhnhgkkflepkmeygyaenflymmfaddesykpdelhikamdtifmlhadheqnasts
    tvrlsgstgnspyaaiiagitalwgpahgganeavlkmlseigstenidkyiakakdklm
    gfghrvykntdpratamkknceeilaklghsdnplltvakkleeialerklfsnvdfysg
    iilkamgipedmftaifalartsgwisqwiemvndpaqkigrprqlytgatnrnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3msuB (B:)
    snamevmlmskyatlkyadknieielpvyspslgndcidvsslvkhgiftydpgfmstaa
    ceskityidggkgvllhrgypieewtqksnyrtlcyaliygelptdeqvksfrqeiinkm
    pvcehvkaaiaampqhthpmssliagvnvlaaehihngqkesqdevaknivakiatiaam
    ayrhnhgkkflepkmeygyaenflymmfaddesykpdelhikamdtifmlhadheqnast
    stvrlsgstgnspyaaiiagitalwgpahgganeavlkmlseigstenidkyiakakdkd
    dpfrlmgfghrvykntdpratamkknceeilaklghsdnplltvakkleeialqdeffie
    rklfsnvdfysgiilkamgipedmftaifalartsgwisqwiemvndpaqkigrprqlyt
    gatnrnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3msuB (B:)
    namevmlmskyatlkyadknieielpvyspslgndcidvsslvkhgiftydpgfmstaac
    eskityidggkgvllhrgypieewtqksnyrtlcyaliygelptdeqvksfrqeiinkmp
    vcehvkaaiaampqhthpmssliagvnvlaaehihngqkesqdevaknivakiatiaama
    yrhnhgkkflepkmeygyaenflymmfaddesykpdelhikamdtifmlhadheqnasts
    tvrlsgstgnspyaaiiagitalwgpahgganeavlkmlseigstenidkyiakakdkdd
    pfrlmgfghrvykntdpratamkknceeilaklghsdnplltvakkleeialqdeffier
    klfsnvdfysgiilkamgipedmftaifalartsgwisqwiemvndpaqkigrprqlytg
    atnrnf