PDB entry 3mst

View 3mst on RCSB PDB site
Description: crystal structure of a putative nitrate transport protein (tvn0104) from thermoplasma volcanium at 1.35 a resolution
Deposited on 2010-04-29, released 2011-02-09
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative nitrate transport protein
    Species: Thermoplasma volcanium [TaxId:50339]
    Gene: TV0103, TVG0108190
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97CJ8 (19-243)
      • leader sequence (11-18)
      • see remark 999 (26)
  • Heterogens: UNL, CL, ACT, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mstA (A:)
    mgsdkihhhhhhenlyfqgmdvgmpfsgpvsfpllvieeelpfrihnicsetgkfdvvld
    sitnmpkyglkifagvridmysilgdessgriytlrkgtladfnarilayydkaqvinad
    gdtcikmanegysalvgneisigksfrnrmkelgldlpscamastrridevieayeqgid
    fiknnheraaeiiskksgyyseevmkkiigiyghevtkkraelvgsrelysrvvpelndi
    eiig
    

    Sequence, based on observed residues (ATOM records):
    >3mstA (A:)
    henlyfqgmdvgmpfsgpvsfpllvieeelpfrihnicsetgkfdvvldsitnmpkyglk
    ifagvridmysilgdessgriytlrkgtladfnarilayydkaqvinadgdtcikmaneg
    ysalvgneisigksfrnrmkelgldlpscamastrridevieayeqgidfiknnheraae
    iiskksgyyseevmkkiigiyghevtkkraelvgsrelysrvvpelndieiig