PDB entry 3msp

View 3msp on RCSB PDB site
Description: motile major sperm protein (msp) of ascaris suum, nmr, 20 structures
Class: cell motility protein
Keywords: cell motility protein, major sperm protein, amoeboid motility, nmr structure, filaments, polymerization
Deposited on 1998-09-10, released 1999-04-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major sperm protein
    Species: Ascaris suum [TaxId:6253]
    Gene: ALPHA MSP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mspa_
  • Chain 'B':
    Compound: major sperm protein
    Species: Ascaris suum [TaxId:6253]
    Gene: ALPHA MSP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3mspb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mspA (A:)
aqsvppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcg
vldpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknl
pieynl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mspB (B:)
aqsvppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcg
vldpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknl
pieynl