PDB entry 3msp

View 3msp on RCSB PDB site
Description: motile major sperm protein (msp) of ascaris suum, nmr, 20 structures
Deposited on 1998-09-10, released 1999-04-20
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d3mspa_
  • Chain 'B':
    Domains in SCOP 1.55: d3mspb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mspA (A:)
    aqsvppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcg
    vldpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknl
    pieynl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mspB (B:)
    aqsvppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcg
    vldpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknl
    pieynl