PDB entry 3mso

View 3mso on RCSB PDB site
Description: crystal structure of a steroid delta-isomerase (np_250810.1) from pseudomonas aeruginosa at 2.57 a resolution
Deposited on 2010-04-29, released 2010-06-09
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA2120
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: steroid delta-isomerase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA2120
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3msoA (A:)
    gmtslpleanaaatlaewhgliarrdlsglprllhpdavfrspmahkpyagapvvsmiln
    tvltvfedfayhrqlasadgrsvvlefsarvgerelkgidmirfdddgrivdfevmvrpm
    sglqalgeemgrrlasylaaska
    

    Sequence, based on observed residues (ATOM records):
    >3msoA (A:)
    tslpleanaaatlaewhgliarrdlsglprllhpdavfrspmahkpyagapvvsmilntv
    ltvfedfayhrqlasadgrsvvlefsarvgerelkgidmirfdddgrivdfevmvrpmsg
    lqalgeemgrrlas
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3msoB (B:)
    gmtslpleanaaatlaewhgliarrdlsglprllhpdavfrspmahkpyagapvvsmiln
    tvltvfedfayhrqlasadgrsvvlefsarvgerelkgidmirfdddgrivdfevmvrpm
    sglqalgeemgrrlasylaaska
    

    Sequence, based on observed residues (ATOM records):
    >3msoB (B:)
    slpleanaaatlaewhgliarrdlsglprllhpdavfrspmahkpyagapvvsmilntvl
    tvfedfayhrqlasadgrsvvlefsarvgerelkgidmirfdddgrivdfevmvrpmsgl
    qalgeemgrrlasylaa