PDB entry 3msh

View 3msh on RCSB PDB site
Description: Crystal structure of Hepatitis B X-Interacting Protein at high resolution
Deposited on 2010-04-29, released 2010-11-10
The last revision was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.183
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatitis B virus X-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: HBXIP, XIP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, IPA, PO4, PG4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mshA (A:)
    meatleqhledtmknpsivgvlctdsqglnlgcrgtlsdehagvisvlaqqaakltsdpt
    dipvvclesdngnimiqkhdgitvavhkmaslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mshA (A:)
    meatleqhledtmknpsivgvlctdsqglnlgcrgtlsdehagvisvlaqqaakltsdpt
    dipvvclesdngnimiqkhdgitvavhkma