PDB entry 3msg

View 3msg on RCSB PDB site
Description: Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus.
Class: hydrolase
Keywords: xylanase, HYDROLASE
Deposited on 2010-04-29, released 2011-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intra-cellular xylanase ixt6
    Species: GeoBacillus stearothermophilus [TaxId:1422]
    Gene: XYNA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3msga_
  • Chain 'B':
    Compound: Intra-cellular xylanase ixt6
    Species: GeoBacillus stearothermophilus [TaxId:1422]
    Gene: XYNA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3msgb_
  • Heterogens: XYP, NA, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3msgA (A:)
    mnsslpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkft
    fqeadrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvr
    rykgkiycwdvineavadegnellrpskwrqiigddfmeqaflyayeadpdallfyndyn
    ecfpekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhit
    eldvsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwl
    dnfpvhgrknwpllfdeqhkpkpafwravsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3msgA (A:)
    nsslpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkftf
    qeadrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvrr
    ykgkiycwdvineavadegnellrpskwrqiigddfmeqaflyayeadpdallfyndyne
    cfpekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhite
    ldvsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwld
    nfpvhgrknwpllfdeqhkpkpafwravsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3msgB (B:)
    mnsslpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkft
    fqeadrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvr
    rykgkiycwdvineavadegnellrpskwrqiigddfmeqaflyayeadpdallfyndyn
    ecfpekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhit
    eldvsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwl
    dnfpvhgrknwpllfdeqhkpkpafwravsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3msgB (B:)
    slpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkftfqe
    adrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvrryk
    gkiycwdvineavadegnellrpskwrqiigddfmeqaflyayeadpdallfyndynecf
    pekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhiteld
    vsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwldnf
    pvhgrknwpllfdeqhkpkpafwravsv