PDB entry 3mse

View 3mse on RCSB PDB site
Description: crystal structure of c-terminal domain of pf110239.
Deposited on 2010-04-29, released 2010-06-23
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Calcium-dependent protein kinase, putative
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PF11_0239
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mseB (B:)
    gispnvlnnmksymkhsnirniiinimahelsvinnhikyinelfykldtnhngslshre
    iytvlasvgikkwdinrilqaldindrgnitytefmagcyrwkniestflkaafnkidkd
    edgyisksdivslvhdkvldnndidnfflsvhsikkgiprehiinkisfqefkdymlstf
    

    Sequence, based on observed residues (ATOM records):
    >3mseB (B:)
    ispnvlnnmksymkhsnirniiinimahelsvinnhikyinelfykldtnhngslshrei
    ytvlasvgikkwdinrilqaldindrgnitytefmagcyrwknitflkaafnkidkdedg
    yisksdivslvhdkvldnndidnfflsvhsiinkisfqefkdymlstf