PDB entry 3msa

View 3msa on RCSB PDB site
Description: Crystal structure of Thermolysin in complex with 3-Bromophenol
Class: hydrolase
Keywords: PROTEASE, HYDROLASE, Fragment soaking, METALLOPROTEASE, Metal-binding, Secreted, Zymogen, 3-Bromophenol, Fragment based lead discovery
Deposited on 2010-04-29, released 2011-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thermolysin
    Species: Bacillus thermoproteolyticus [TaxId:1427]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3msaa_
  • Heterogens: B3R, ZN, CA, GOL, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3msaA (A:)
    itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
    qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
    vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
    nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
    aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
    qevasvkqafdavgvk