PDB entry 3ms3

View 3ms3 on RCSB PDB site
Description: Crystal structure of Thermolysin in complex with Aniline
Class: hydrolase
Keywords: PROTEASE, HYDROLASE, Aniline, Fragement soaking, Fragment based lead discovery, METALLOPROTEASE, Metal-binding, Secreted, Zymogen
Deposited on 2010-04-29, released 2011-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thermolysin
    Species: Bacillus thermoproteolyticus [TaxId:1427]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ms3a_
  • Heterogens: ZN, CA, ANL, IPA, GOL, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ms3A (A:)
    itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
    qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
    vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
    nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
    aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
    qevasvkqafdavgvk