PDB entry 3ms1

View 3ms1 on RCSB PDB site
Description: Recognition of the amber stop codon by release factor RF1. This entry 3MS1 contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 3MR8. Molecule B in the same asymmetric unit is deposited as 3MRZ (50S) and 3MS0 (30S).
Deposited on 2010-04-29, released 2010-07-14
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.62 Å
R-factor: 0.26
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: 50S ribosomal protein L31
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain '2':
    Compound: 50S ribosomal protein L32
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: 50S ribosomal protein L33
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: 50S ribosomal protein L34
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain '5':
    Compound: 50S ribosomal protein L35
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: 23S ribosomal RNA
    Species: Thermus thermophilus [TaxId:262724]
  • Chain 'B':
    Compound: 5S ribosomal RNA
    Species: Thermus thermophilus [TaxId:262724]
  • Chain 'C':
    Compound: 50S ribosomal protein L2
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 50S ribosomal protein L3
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 50S ribosomal protein L4
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 50S ribosomal protein L5
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 50S ribosomal protein L6
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 50S ribosomal protein L9
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 50s ribosomal protein l10
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 50S ribosomal protein L13
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 50S ribosomal protein L14
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 50S ribosomal protein L15
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 50S ribosomal protein L16
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 50S ribosomal protein L18
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 50S ribosomal protein L19
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 50S ribosomal protein L20
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 50S ribosomal protein L21
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 50S ribosomal protein L22
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 50S ribosomal protein L23
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: 50S ribosomal protein L24
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: 50S ribosomal protein L25
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: 50S ribosomal protein L27
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: 50S ribosomal protein L28
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: 50S ribosomal protein L29
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: 50S ribosomal protein L30
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '1':
    Sequence, based on SEQRES records:
    >3ms11 (1:)
    mkegihpklvpariicgcgnvietystkpeiyvevcskchpfytgqqrfvdtegrverfq
    rrygdsyrkgr
    

    Sequence, based on observed residues (ATOM records):
    >3ms11 (1:)
    vpariicgcgnvietystkpeiyvevcskc
    

  • Chain '2':
    Sequence, based on SEQRES records:
    >3ms12 (2:)
    akhpvpkkktskarrdarrshhaltppilvpcpeckamkpphtvcpecgyyagrkvlev
    

    Sequence, based on observed residues (ATOM records):
    >3ms12 (2:)
    akhpvpkkktskarrdarrshhaltppilvpcpeckamkpphtvcpecgyya
    

  • Chain '3':
    Sequence, based on SEQRES records:
    >3ms13 (3:)
    masevriklllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevki
    

    Sequence, based on observed residues (ATOM records):
    >3ms13 (3:)
    lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrev
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records:
    >3ms14 (4:)
    mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrk
    

  • Chain '5':
    Sequence, based on SEQRES records:
    >3ms15 (5:)
    pkmkthkgakkrvkitasgkvvamktgkrhlnwqksgkeirqkgrkfvlakpeaerikll
    lpye
    

    Sequence, based on observed residues (ATOM records):
    >3ms15 (5:)
    pkmkthkgakkrvkitasgkvvamktgkrhlnwqksgkeirqkgrkfvlakpeaerikll
    lpy
    

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3ms1C (C:)
    avkkfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkrl
    yriidfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvagp
    dapiqvgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsge
    lrkvhgecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegrap
    rgrppaspwgwqtkglktrkrrkpssrfiiarrkk
    

    Sequence, based on observed residues (ATOM records):
    >3ms1C (C:)
    avkkfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkrl
    yriidfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvagp
    dapiqvgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsge
    lrkvhgecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegrap
    rgrppaspwgwqtkglktrkrrkpssrfiia
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3ms1D (D:)
    mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn
    rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw
    nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen
    lllvkgavpgpngglvivretkkaak
    

    Sequence, based on observed residues (ATOM records):
    >3ms1D (D:)
    mkgilgvkvgmtrifrddravpvtvilagpcpvvqrrtpekdgytavqlgflpqnpkrvn
    rplkghfakagvepvrilreirdfnpegdtvtveifkpgervdvtgtskgrgfagvmkrw
    nfaggpdshgahkihrhpgsignrktpgrvykgkkmaghygaervtvmnlevvdvipeen
    lllvkgavpgpngglvivretkka
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3ms1E (E:)
    myqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevaysgrkiw
    pqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadraregklll
    veafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeglnvyd
    ivrterlvmdldawevfqnriggea
    

    Sequence, based on observed residues (ATOM records):
    >3ms1E (E:)
    myqipvlspsgrrelaadlpaeinphllwevvrwqlakrrrgtastktrgevaysgrkiw
    pqkhtgrarhgdigapifvgggvvfgpkprdysytlpkkvrkkglamavadraregklll
    veafagvngktkeflawakeagldgsesvllvtgnelvrraarnlpwvvtlapeglnvyd
    ivrterlvmdldawevfqnrig
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >3ms1F (F:)
    pldlalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqela
    litgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrgln
    pnsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfr
    k
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3ms1G (G:)
    msrigrlpipvpkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderr
    hkslhgltrtlianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppeg
    itfevpeptrvrvsgidkqkvgqvaanirairkpsayhekgiyyagepvrlkpgkagakk
    

    Sequence, based on observed residues (ATOM records):
    >3ms1G (G:)
    pkgvsvevapgrvkvkgpkgelevpvspemrvvveegvvrverpsderrhkslhgltrtl
    ianavkgvsegyskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrv
    rvsgidkqkvgqvaanirairkpsayhekgiyyagepvr
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3ms1H (H:)
    mkvilleplenlgdvgqvvdvkpgyarnyllprglavlatesnlkaleariraqakrlae
    rkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgitidpkrlalekpi
    kelgeyvltykphpevpiqlkvsvvaqe
    

    Sequence, based on observed residues (ATOM records):
    >3ms1H (H:)
    mkvilleplenlgdvgqvvdvkpgyarnyllprglavlatesnlkaleariraqakrlae
    rkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgitidpkrlalekpi
    kelgeyvltykphpevpiqlkvsvv
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >3ms1I (I:)
    mpnkrnvellatlkenleraqgsfflvnyqglpakethalrqalkqngarlfvakntlir
    lalkelglpeldglqgpsavvfyedpvaaaktlvqfaksnpkgipqvksgllqgqiltak
    dvealaelptmdelraelvgvlqapmaelvgvlggvarelvgileayaekkaa
    

    Sequence, based on observed residues (ATOM records):
    >3ms1I (I:)
    nkrnvellatlkenleraqgntlirlalkelg
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >3ms1J (J:)
    ktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadkir
    vtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrlk
    vyagpdhphqaqrpeklev
    

    Sequence, based on observed residues (ATOM records):
    >3ms1J (J:)
    ktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadkir
    vtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrlk
    vyagpdhphqaqrpekl
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >3ms1K (K:)
    miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
    vvvrtkkevkrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
    vl
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >3ms1L (L:)
    mklsdlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlm
    rlpkrgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegea
    kplkvvahafsksaleklkaaggepvllea
    

    Sequence, based on observed residues (ATOM records):
    >3ms1L (L:)
    dlrpnpgankrrkrvgrgpgsghgktatrghkgqksrsgglkdprrfeggrsttlmrlpk
    rgmqgqvpgeikrpryqgvnlkdlarfegevtpellvragllkkgyrlkilgegeakplk
    vvahafsksaleklkaaggepvllea
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >3ms1M (M:)
    mlmprrmkyrkqqrgrlkgatkggdyvafgdfglvalepawitaqqieaarvamvrhfrr
    ggkifirifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealri
    aghklpiktkivrrdaydeaq
    

    Sequence, based on observed residues (ATOM records):
    >3ms1M (M:)
    rmkyrkqqrgrlkgatkggdyvafgdfglvalepawitaqqieaarvamvrhfrrggkif
    irifpdkpytkkplevrmgkgkgnvegyvavvkpgrvmfevagvteeqamealriaghkl
    piktkivrrdaydeaq
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records:
    >3ms1N (N:)
    rhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlh
    arrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >3ms1O (O:)
    arltayerrkfrvrnrikrtgrlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgn
    ktevarqvgralaekalalgikqvafdrgpykyhgrvkalaegaregglef
    

    Sequence, based on observed residues (ATOM records):
    >3ms1O (O:)
    kfrvrnrikrtgrlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgnktevarqvg
    ralaekalalgikqvafdrgpykyhgrvkalaegareg
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >3ms1P (P:)
    mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
    ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
    idkdraaeraakeevqkaqepeasqe
    

    Sequence, based on observed residues (ATOM records):
    >3ms1P (P:)
    mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
    ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
    idkdraaeraakeevqk
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >3ms1Q (Q:)
    praktgvvrrrkhkkilklakgywglrsksrkaretlfaagnyayahrkrrkrdfrrlwi
    vrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records:
    >3ms1R (R:)
    mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
    vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records:
    >3ms1S (S:)
    meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
    nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgekhg
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >3ms1T (T:)
    mktaydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvr
    gkkkrlgrylgkrpdrkkaivqvapgqkiealegli
    

    Sequence, based on observed residues (ATOM records):
    >3ms1T (T:)
    taydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvrgk
    kkrlgrylgkrpdrkkaivqvapgqkiealeg
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >3ms1U (U:)
    rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi
    ekeaplhaskvrpicpacgkptrvrkkflengkkirvcakcggaldtee
    

    Sequence, based on observed residues (ATOM records):
    >3ms1U (U:)
    rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi
    ekeaplhaskvrpicpacgkptrvrkkflengkkirvcak
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >3ms1V (V:)
    meyrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivle
    lpdgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqei
    hrdilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppedv
    eklaeeaaaevaepevikkgkeeeee
    

    Sequence, based on observed residues (ATOM records):
    >3ms1V (V:)
    yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp
    dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr
    dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvppedvek
    laeeaaae
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >3ms1W (W:)
    ahkkglgstkngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfa
    lvdgvvefqdrgrlgryvhvrpla
    

    Sequence, based on observed residues (ATOM records):
    >3ms1W (W:)
    tkngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvef
    qdrgrlgryvhvrpla
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >3ms1X (X:)
    mskvceisgkrpivansiqrrgkakreggvgkkttgiskrrqypnlqkvrvrvagqeitf
    rvaashipkvyelverakglrleglspkeikkellkll
    

    Sequence, based on observed residues (ATOM records):
    >3ms1X (X:)
    sgkrpivansiqrrgkakreggvgkkttgiskrrqypnlqkvrvrvagqeitfrvaashi
    pkvyelverakglrleglspkeikkell
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >3ms1Y (Y:)
    mklsevrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarl
    ltvlnekrrqna
    

    Sequence, based on observed residues (ATOM records):
    >3ms1Y (Y:)
    mklsevrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarl
    lt
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records:
    >3ms1Z (Z:)
    mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevv