PDB entry 3mrx

View 3mrx on RCSB PDB site
Description: Glycogen phosphorylase complexed with 4-methoxybenzaldehyde-4-(2,3,4,6-tetra-O-acetyl-beta-D-glucopyranosyl)-thiosemicarbazone
Class: transferase/transferase inhibitor
Keywords: Glycogenolysis, type 2 diabetes, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-04-29, released 2011-01-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.184
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mrxa_
  • Heterogens: 17S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mrxA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mrxA (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    fnlggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksstn
    fdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpeale
    rwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlc
    iagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiae
    rigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdv
    qvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklita
    igdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlng
    altigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieql
    ssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirni
    atsgkfssdrtiaqyareiwgvepsrqrlpa