PDB entry 3mru

View 3mru on RCSB PDB site
Description: Crystal Structure of Aminoacylhistidine Dipeptidase from Vibrio alginolyticus
Deposited on 2010-04-29, released 2010-09-01
The last revision was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.231
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminoacyl-histidine dipeptidase
    Species: Vibrio alginolyticus [TaxId:663]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Aminoacyl-histidine dipeptidase
    Species: Vibrio alginolyticus [TaxId:663]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3mruA (A:)
    msefhseistlspaplwqffdkicsiphpskheealaqyivtwateqgfdvrrdptgnvf
    ikkpatpgmenkkgvvlqahidmvpqknedtdhdftqdpiqpyidgewvtakgttlgadn
    gigmasclavlaskeikhgpievlltideeagmtgafgleagwlkgdillntdseqegev
    ymgcaggidgamtfditrdaipagfitrqltlkglkgghsgcdihtgrgnankligrfla
    ghaqeldlrlvefrggslrnaipreafvtvalpaenqdklaelfnyytellktelgkiet
    divtfneevatdaqvfaiadqqrfiaalnacpngvmrmsdevegvvetslnvgvitteen
    kvtvlclirslidsgrsqvegmlqsvaelagaqiefsgaypgwkpdadseimaifrdmye
    giyghkpnimvihaglecglfkepypnmdmvsfgptikfphspdekvkidtvqlfwdqmv
    alleaipeka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3mruB (B:)
    msefhseistlspaplwqffdkicsiphpskheealaqyivtwateqgfdvrrdptgnvf
    ikkpatpgmenkkgvvlqahidmvpqknedtdhdftqdpiqpyidgewvtakgttlgadn
    gigmasclavlaskeikhgpievlltideeagmtgafgleagwlkgdillntdseqegev
    ymgcaggidgamtfditrdaipagfitrqltlkglkgghsgcdihtgrgnankligrfla
    ghaqeldlrlvefrggslrnaipreafvtvalpaenqdklaelfnyytellktelgkiet
    divtfneevatdaqvfaiadqqrfiaalnacpngvmrmsdevegvvetslnvgvitteen
    kvtvlclirslidsgrsqvegmlqsvaelagaqiefsgaypgwkpdadseimaifrdmye
    giyghkpnimvihaglecglfkepypnmdmvsfgptikfphspdekvkidtvqlfwdqmv
    alleaipeka