PDB entry 3mrs

View 3mrs on RCSB PDB site
Description: Crystal structure of shikimate kinase mutant (R57A) from Helicobacter pylori
Class: Transferase
Keywords: helix-sheet complex, Transferase
Deposited on 2010-04-29, released 2011-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.247
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate kinase
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene: AroK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56073 (6-167)
      • engineered mutation (62)
    Domains in SCOPe 2.07: d3mrsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mrsA (A:)
    hhhhhhmqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelged
    nfamfeknlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlnqkere
    krpllnnltqakelfekrqalyeknasfiidargglnnslkqvlqfia
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mrsA (A:)
    mqhlvligfmgsgksslaqelglalklevldtdmiiservglsvreifeelgednfamfe
    knlidelktlktphvistgggivmhenlkglgttfylkmdfetlikrlltqakelfekrq
    alyeknasfiidargglnnslkqvlqfia