PDB entry 3mr7

View 3mr7 on RCSB PDB site
Description: Crystal Structure of Adenylate/Guanylate Cyclase/Hydrolase from Silicibacter pomeroyi
Class: hydrolase
Keywords: alpha-beta fold, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, HYDROLASE
Deposited on 2010-04-28, released 2010-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-06-23, with a file datestamp of 2010-06-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.184
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenylate/guanylate cyclase/hydrolase, alpha/beta fold family
    Species: Ruegeria pomeroyi [TaxId:246200]
    Gene: SPO3024
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LP28 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3mr7a1, d3mr7a2
  • Chain 'B':
    Compound: Adenylate/guanylate cyclase/hydrolase, alpha/beta fold family
    Species: Ruegeria pomeroyi [TaxId:246200]
    Gene: SPO3024
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LP28 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3mr7b1, d3mr7b2
  • Chain 'C':
    Compound: Adenylate/guanylate cyclase/hydrolase, alpha/beta fold family
    Species: Ruegeria pomeroyi [TaxId:246200]
    Gene: SPO3024
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LP28 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d3mr7c1, d3mr7c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mr7A (A:)
    snaerrlcailaadmagysrlmernetdvlnrqklyrrelidpaiaqaggqivkttgdgm
    larfdtaqaalrcaleiqqamqqreedtprkeriqyriginigdivledgdifgdavnva
    arleaisepgaicvsdivhqitqdrvsepftdlglqkvknitrpirvwqwvpdadrdqsh
    dpqpshvqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mr7A (A:)
    naerrlcailaadmagysrlmernetdvlnrqklyrrelidpaiaqaggqivkttgdgml
    arfdtaqaalrcaleiqqamqqreedtprkeriqyriginigdivledgdifgdavnvaa
    rleaisepgaicvsdivhqitqdrvsepftdlglqkvknitrpirvwqwvpda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mr7B (B:)
    snaerrlcailaadmagysrlmernetdvlnrqklyrrelidpaiaqaggqivkttgdgm
    larfdtaqaalrcaleiqqamqqreedtprkeriqyriginigdivledgdifgdavnva
    arleaisepgaicvsdivhqitqdrvsepftdlglqkvknitrpirvwqwvpdadrdqsh
    dpqpshvqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mr7B (B:)
    naerrlcailaadmagysrlmernetdvlnrqklyrrelidpaiaqaggqivkttgdgml
    arfdtaqaalrcaleiqqamqqreedtprkeriqyriginigdivledgdifgdavnvaa
    rleaisepgaicvsdivhqitqdrvsepftdlglqkvknitrpirvwqwvpd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mr7C (C:)
    snaerrlcailaadmagysrlmernetdvlnrqklyrrelidpaiaqaggqivkttgdgm
    larfdtaqaalrcaleiqqamqqreedtprkeriqyriginigdivledgdifgdavnva
    arleaisepgaicvsdivhqitqdrvsepftdlglqkvknitrpirvwqwvpdadrdqsh
    dpqpshvqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mr7C (C:)
    aerrlcailaadmagysrlmetdvlnrqklyrrelidpaiaqaggqivkttgdgmlarfd
    taqaalrcaleiqqamqqreedtprkeriqyriginigdivledgdifgdavnvaarlea
    isepgaicvsdivhqitqdrvsepftdlglqkvknitrpirvwqwvpda