PDB entry 3mr6

View 3mr6 on RCSB PDB site
Description: Human DNA polymerase eta - DNA ternary complex with a CPD 2bp upstream of the active site (TT4)
Deposited on 2010-04-28, released 2010-06-30
The last revision was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA Polymerase ETA
    Species: Homo sapiens [TaxId:9606]
    Gene: POLH, RAD30, RAD30A, XPV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y253 (3-434)
      • expression tag (0-2)
      • engineered mutation (408)
  • Chain 'P':
    Compound: DNA (5'-d(*tp*cp*tp*cp*gp*tp*ap*ap*t)-3')
  • Chain 'T':
    Compound: DNA (5'-d(*c*ap*tp*cp*ap*(ttd)p*ap*cp*gp*ap*gp*c)-3')
  • Heterogens: XG4, MG, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mr6A (A:)
    gphmatgqdrvvalvdmdcffvqveqrqnphlrnkpcavvqykswkgggiiavsyearaf
    gvtrsmwaddakklcpdlllaqvresrgkanltkyreasvevmeimsrfavierasidea
    yvdltsavqerlqklqgqpisadllpstyieglpqgpttaeetvqkegmrkqglfqwlds
    lqidnltspdlqltvgaviveemraaieretgfqcsagishnkvlaklacglnkpnrqtl
    vshgsvpqlfsqmpirkirslggklgasvieilgieymgeltqftesqlqshfgekngsw
    lyamcrgiehdpvkprqlpktigcsknfpgktalatreqvqwwllqlaqeleerltkdrn
    dndrvatqlvvsirvqgdkrlsslrrccaltrydahkmshdaftviknmntsgiqtewsp
    pltmlflcatkfsas
    

    Sequence, based on observed residues (ATOM records):
    >3mr6A (A:)
    gphmatgqdrvvalvdmdcffvqveqrqnphlrnkpcavvqykswkgggiiavsyearaf
    gvtrsmwaddakklcpdlllaqvresrgkanltkyreasvevmeimsrfavierasidea
    yvdltsavqerlqklqgqpisadllpstyieglpqgpvqkegmrkqglfqwldslqidnl
    tspdlqltvgaviveemraaieretgfqcsagishnkvlaklacglnkpnrqtlvshgsv
    pqlfsqmpirkirslggklgasvieilgieymgeltqftesqlqshfgekngswlyamcr
    giehdpvkprqlpktigcsknfpgktalatreqvqwwllqlaqeleerltkdrndndrva
    tqlvvsirvqgdkrlsslrrccaltrydahkmshdaftviknmntsgtewsppltmlflc
    atkfsas
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.