PDB entry 3mr4

View 3mr4 on RCSB PDB site
Description: Human DNA polymerase eta - DNA ternary complex with the 5'T of a CPD in the active site (TT2)
Deposited on 2010-04-28, released 2010-07-07
The last revision was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.241
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA Polymerase ETA
    Species: Homo sapiens [TaxId:9606]
    Gene: POLH, RAD30, RAD30A, XPV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y253 (3-End)
      • expression tag (1-2)
  • Chain 'P':
    Compound: DNA (5'-d(*tp*gp*cp*gp*tp*cp*ap*tp*a)-3')
  • Chain 'T':
    Compound: DNA (5'-d(*tp*a*ap*cp*(ttd)p*ap*tp*gp*ap*cp*gp*c)-3')
  • Heterogens: DZ4, MG, CO, GOL, DTT, TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mr4A (A:)
    gphmatgqdrvvalvdmdcffvqveqrqnphlrnkpcavvqykswkgggiiavsyearaf
    gvtrsmwaddakklcpdlllaqvresrgkanltkyreasvevmeimsrfavierasidea
    yvdltsavqerlqklqgqpisadllpstyieglpqgpttaeetvqkegmrkqglfqwlds
    lqidnltspdlqltvgaviveemraaieretgfqcsagishnkvlaklacglnkpnrqtl
    vshgsvpqlfsqmpirkirslggklgasvieilgieymgeltqftesqlqshfgekngsw
    lyamcrgiehdpvkprqlpktigcsknfpgktalatreqvqwwllqlaqeleerltkdrn
    dndrvatqlvvsirvqgdkrlsslrrccaltrydahkmshdaftvikncntsgiqtewsp
    pltmlflcatkfsas
    

    Sequence, based on observed residues (ATOM records):
    >3mr4A (A:)
    phmatgqdrvvalvdmdcffvqveqrqnphlrnkpcavvqykswkgggiiavsyearafg
    vtrsmwaddakklcpdlllaqvresrgkanltkyreasvevmeimsrfavierasideay
    vdltsavqerlqklqgqpisadllpstyieglpqgvqkegmrkqglfqwldslqidnlts
    pdlqltvgaviveemraaieretgfqcsagishnkvlaklacglnkpnrqtlvshgsvpq
    lfsqmpirkirslggklgasvieilgieymgeltqftesqlqshfgekngswlyamcrgi
    ehdpvkprqlpktigcsknfpgktalatreqvqwwllqlaqeleerltkdrndndrvatq
    lvvsirvqgdkrlsslrrccaltrydahkmshdaftvikncniqtewsppltmlflcatk
    fs
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.