PDB entry 3mr2

View 3mr2 on RCSB PDB site
Description: Human DNA polymerase eta in complex with normal DNA and incoming nucleotide (Nrm)
Deposited on 2010-04-28, released 2010-06-30
The last revision was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.174
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA Polymerase ETA
    Species: Homo sapiens [TaxId:9606]
    Gene: POLH, RAD30, RAD30A, XPV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y253 (3-434)
      • expression tag (0-2)
  • Chain 'P':
    Compound: DNA (5'-d(*tp*ap*gp*cp*gp*tp*cp*ap*t)-3')
  • Chain 'T':
    Compound: DNA (5'-d(*t*cp*ap*tp*tp*ap*tp*gp*ap*cp*gp*cp*t)-3')
  • Heterogens: DZ4, MG, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mr2A (A:)
    gphmatgqdrvvalvdmdcffvqveqrqnphlrnkpcavvqykswkgggiiavsyearaf
    gvtrsmwaddakklcpdlllaqvresrgkanltkyreasvevmeimsrfavierasidea
    yvdltsavqerlqklqgqpisadllpstyieglpqgpttaeetvqkegmrkqglfqwlds
    lqidnltspdlqltvgaviveemraaieretgfqcsagishnkvlaklacglnkpnrqtl
    vshgsvpqlfsqmpirkirslggklgasvieilgieymgeltqftesqlqshfgekngsw
    lyamcrgiehdpvkprqlpktigcsknfpgktalatreqvqwwllqlaqeleerltkdrn
    dndrvatqlvvsirvqgdkrlsslrrccaltrydahkmshdaftvikncntsgiqtewsp
    pltmlflcatkfsas
    

    Sequence, based on observed residues (ATOM records):
    >3mr2A (A:)
    gphmatgqdrvvalvdmdcffvqveqrqnphlrnkpcavvqykswkgggiiavsyearaf
    gvtrsmwaddakklcpdlllaqvresrgkanltkyreasvevmeimsrfavierasidea
    yvdltsavqerlqklqgqpisadllpstyieglpqgpeetvqkegmrkqglfqwldslqi
    dnltspdlqltvgaviveemraaieretgfqcsagishnkvlaklacglnkpnrqtlvsh
    gsvpqlfsqmpirkirslggklgasvieilgieymgeltqftesqlqshfgekngswlya
    mcrgiehdpvkprqlpktigcsknfpgktalatreqvqwwllqlaqeleerltkdrndnd
    rvatqlvvsirvqgdkrlsslrrccaltrydahkmshdaftvikncntsgtewsppltml
    flcatkfsas
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.