PDB entry 3mr1

View 3mr1 on RCSB PDB site
Description: Crystal structure of methionine aminopeptidase from Rickettsia prowazekii
Class: hydrolase
Keywords: NIAID, Seattle Structural Genomics Center for Infectious Disease, SSGCID, protease, aminopeptidase, metalloenzyme, epidemic typhus, lice-born pathogen, HYDROLASE
Deposited on 2010-04-28, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Rickettsia prowazekii [TaxId:782]
    Gene: map, Q9ZCD3, RP824
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZCD3 (5-251)
      • expression tag (3-4)
    Domains in SCOPe 2.07: d3mr1a1, d3mr1a2
  • Chain 'B':
    Compound: Methionine aminopeptidase
    Species: Rickettsia prowazekii [TaxId:782]
    Gene: map, Q9ZCD3, RP824
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZCD3 (5-251)
      • expression tag (4)
    Domains in SCOPe 2.07: d3mr1b1, d3mr1b2
  • Chain 'C':
    Compound: Methionine aminopeptidase
    Species: Rickettsia prowazekii [TaxId:782]
    Gene: map, Q9ZCD3, RP824
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZCD3 (5-251)
      • expression tag (3-4)
    Domains in SCOPe 2.07: d3mr1c1, d3mr1c2
  • Chain 'D':
    Compound: Methionine aminopeptidase
    Species: Rickettsia prowazekii [TaxId:782]
    Gene: map, Q9ZCD3, RP824
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZCD3 (5-251)
      • expression tag (3-4)
    Domains in SCOPe 2.07: d3mr1d1, d3mr1d2
  • Heterogens: MN, NA, PO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mr1A (A:)
    gpgsmikihtekdfikmraagklaaetldfitdhvkpnvttnslndlchnfitshnaipa
    plnykgfpksictsinhvvchgipndkplkngdivnidvtvildgwygdtsrmyyvgdva
    ikpkrliqvtydammkgievvrpgaklgdigyaiqsyaekhnysvvrdytghgigrvfhd
    kpsilnygrngtgltlkegmfftvepminagnydtilskldgwtvttrdkslsaqfehti
    gvtkdgfeiftl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mr1A (A:)
    smikihtekdfikmraagklaaetldfitdhvkpnvttnslndlchnfitshnaipapln
    ykgfpksictsinhvvchgipndkplkngdivnidvtvildgwygdtsrmyyvgdvaikp
    krliqvtydammkgievvrpgaklgdigyaiqsyaekhnysvvrdytghgigrvfhdkps
    ilnygrngtgltlkegmfftvepminagnydtilskldgwtvttrdkslsaqfehtigvt
    kdgfeiftl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mr1B (B:)
    gpgsmikihtekdfikmraagklaaetldfitdhvkpnvttnslndlchnfitshnaipa
    plnykgfpksictsinhvvchgipndkplkngdivnidvtvildgwygdtsrmyyvgdva
    ikpkrliqvtydammkgievvrpgaklgdigyaiqsyaekhnysvvrdytghgigrvfhd
    kpsilnygrngtgltlkegmfftvepminagnydtilskldgwtvttrdkslsaqfehti
    gvtkdgfeiftl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mr1B (B:)
    mikihtekdfikmraagklaaetldfitdhvkpnvttnslndlchnfitshnaipaplny
    kgfpksictsinhvvchgipndkplkngdivnidvtvildgwygdtsrmyyvgdvaikpk
    rliqvtydammkgievvrpgaklgdigyaiqsyaekhnysvvrdytghgigrvfhdkpsi
    lnygrngtgltlkegmfftvepminagnydtilskldgwtvttrdkslsaqfehtigvtk
    dgfeiftl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mr1C (C:)
    gpgsmikihtekdfikmraagklaaetldfitdhvkpnvttnslndlchnfitshnaipa
    plnykgfpksictsinhvvchgipndkplkngdivnidvtvildgwygdtsrmyyvgdva
    ikpkrliqvtydammkgievvrpgaklgdigyaiqsyaekhnysvvrdytghgigrvfhd
    kpsilnygrngtgltlkegmfftvepminagnydtilskldgwtvttrdkslsaqfehti
    gvtkdgfeiftl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mr1C (C:)
    smikihtekdfikmraagklaaetldfitdhvkpnvttnslndlchnfitshnaipapln
    ykgfpksictsinhvvchgipndkplkngdivnidvtvildgwygdtsrmyyvgdvaikp
    krliqvtydammkgievvrpgaklgdigyaiqsyaekhnysvvrdytghgigrvfhdkps
    ilnygrngtgltlkegmfftvepminagnydtilskldgwtvttrdkslsaqfehtigvt
    kdgfeiftl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mr1D (D:)
    gpgsmikihtekdfikmraagklaaetldfitdhvkpnvttnslndlchnfitshnaipa
    plnykgfpksictsinhvvchgipndkplkngdivnidvtvildgwygdtsrmyyvgdva
    ikpkrliqvtydammkgievvrpgaklgdigyaiqsyaekhnysvvrdytghgigrvfhd
    kpsilnygrngtgltlkegmfftvepminagnydtilskldgwtvttrdkslsaqfehti
    gvtkdgfeiftl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mr1D (D:)
    smikihtekdfikmraagklaaetldfitdhvkpnvttnslndlchnfitshnaipapln
    ykgfpksictsinhvvchgipndkplkngdivnidvtvildgwygdtsrmyyvgdvaikp
    krliqvtydammkgievvrpgaklgdigyaiqsyaekhnysvvrdytghgigrvfhdkps
    ilnygrngtgltlkegmfftvepminagnydtilskldgwtvttrdkslsaqfehtigvt
    kdgfeiftl