PDB entry 3mqu

View 3mqu on RCSB PDB site
Description: crystal structure of a putative ntp pyrophosphohydrolase (exig_1061) from exiguobacterium sp. 255-15 at 1.79 a resolution
Deposited on 2010-04-28, released 2010-05-26
The last revision was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.177
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative NTP pyrophosphohydrolase
    Species: Exiguobacterium sibiricum [TaxId:262543]
    Gene: Exig_1061
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mquA (A:)
    gmkqpnyyqdvkqfhqtfhhpgadqptaipldrgvkratwtaeeavveflhqssqnetef
    laaietfkagldqavkkslketypvteverlvgqgdaltdalyfimgsfveaglepgplf
    eivqqanmaklgpdgqpifresdqkvmkpdgwlppepqleaevvrqmkeka
    

    Sequence, based on observed residues (ATOM records):
    >3mquA (A:)
    kqpnyyqdvkqfhqtfhhpgadqptaipldrgvkratwtaeeavveflhqssqnetefla
    aietfkagldqavkkslketypvteverlvgqgdaltdalyfimgsfveaglepgplfei
    vqqanmaklgpdgqpifresdqkvmkpdgwlppepqleaevvrqmkeka