PDB entry 3mqt

View 3mqt on RCSB PDB site
Description: Crystal structure of a mandelate racemase/muconate lactonizing enzyme from Shewanella pealeana
Deposited on 2010-04-28, released 2010-05-12
The last revision was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.186
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Shewanella pealeana [TaxId:398579]
    Gene: Spea_3246
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mqtA (A:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtA (A:)
    anivsvefipvnvaentvivkvtdengvyglgeadgppecmkafseienehkwlnnikea
    vigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmggaq
    kaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeivay
    lrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqklaa
    aintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmph
    nwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpgl
    gielniefveqvtghkf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mqtB (B:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtB (B:)
    anivsvefipvnvaentvivkvtdengvyglgeadgppecmkafseienehkwlnnikea
    vigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmggaq
    kaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeivay
    lrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqklaa
    aintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmph
    nwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpgl
    gielniefveqvtghkf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mqtC (C:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtC (C:)
    anivsvefipvnvaentvivkvtdengvyglgeadgppecmkafseienehkwlnnikea
    vigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmggaq
    kaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeivay
    lrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqklaa
    aintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmph
    nwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpgl
    gielniefveqvtghkf
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mqtD (D:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtD (D:)
    anivsvefipvnvaentvivkvtdengvyglgeadgppecmkafseienehkwlnnikea
    vigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmggaq
    kaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeivay
    lrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqklaa
    aintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmph
    nwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpgl
    gielniefveqvtghkf
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mqtE (E:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtE (E:)
    anivsvefipvnvasentvivkvtdengvyglgeadgppecmkafseienehkwlnnike
    avigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmgga
    qkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeiva
    ylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqkla
    aaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmp
    hnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpg
    lgielniefveqvtghkf
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mqtF (F:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtF (F:)
    anivsvefipvnvasentvivkvtdengvyglgeadgppecmkafseienehkwlnnike
    avigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmgga
    qkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeiva
    ylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqkla
    aaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmp
    hnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpg
    lgielniefveqvtghkf
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3mqtG (G:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtG (G:)
    anivsvefipvnvaentvivkvtdengvyglgeadgppecmkafseienehkwlnnikea
    vigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmggaq
    kaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeivay
    lrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqklaa
    aintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmph
    nwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpgl
    gielniefveqvtghkf
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3mqtH (H:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtH (H:)
    anivsvefipvnvasentvivkvtdengvyglgeadgppecmkafseienehkwlnnike
    avigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmgga
    qkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeiva
    ylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqkla
    aaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmp
    hnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpg
    lgielniefveqvtghkf
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >3mqtI (I:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtI (I:)
    anivsvefipvnvasentvivkvtdengvyglgeadgppecmkafseienehkwlnnike
    avigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmgga
    qkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeiva
    ylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqkla
    aaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmp
    hnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpg
    lgielniefveqvtghkf
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >3mqtJ (J:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtJ (J:)
    anivsvefipvnvasentvivkvtdengvyglgeadgppecmkafseienehkwlnnike
    avigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmgga
    qkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeiva
    ylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqkla
    aaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmp
    hnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpg
    lgielniefveqvtghkf
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >3mqtK (K:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtK (K:)
    anivsvefipvnvasentvivkvtdengvyglgeadgppecmkafseienehkwlnnike
    avigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmgga
    qkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeiva
    ylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqkla
    aaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmp
    hnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpg
    lgielniefveqvtghkf
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >3mqtL (L:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtL (L:)
    anivsvefipvnvasentvivkvtdengvyglgeadgppecmkafseienehkwlnnike
    avigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmgga
    qkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeiva
    ylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqkla
    aaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmp
    hnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpg
    lgielniefveqvtghkf
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >3mqtM (M:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtM (M:)
    anivsvefipvnvaentvivkvtdengvyglgeadgppecmkafseienehkwlnnikea
    vigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmggaq
    kaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeivay
    lrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqklaa
    aintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmph
    nwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpgl
    gielniefveqvtghkf
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >3mqtN (N:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtN (N:)
    anivsvefipvnvaentvivkvtdengvyglgeadgppecmkafseienehkwlnnikea
    vigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmggaq
    kaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeivay
    lrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqklaa
    aintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmph
    nwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpgl
    gielniefveqvtghkf
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >3mqtO (O:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtO (O:)
    anivsvefipvnvasentvivkvtdengvyglgeadgppecmkafseienehkwlnnike
    avigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmgga
    qkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeiva
    ylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqkla
    aaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmp
    hnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpg
    lgielniefveqvtghkf
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >3mqtP (P:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtP (P:)
    anivsvefipvnvasentvivkvtdengvyglgeadgppecmkafseienehkwlnnike
    avigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmgga
    qkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeiva
    ylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqkla
    aaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmp
    hnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpg
    lgielniefveqvtghkf
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >3mqtQ (Q:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtQ (Q:)
    anivsvefipvnvasentvivkvtdengvyglgeadgppecmkafseienehkwlnnike
    avigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmgga
    qkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeiva
    ylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqkla
    aaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmp
    hnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpg
    lgielniefveqvtghkf
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >3mqtR (R:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtR (R:)
    anivsvefipvnvasentvivkvtdengvyglgeadgppecmkafseienehkwlnnike
    avigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmgga
    qkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeiva
    ylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqkla
    aaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmp
    hnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpg
    lgielniefveqvtghkf
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >3mqtS (S:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtS (S:)
    anivsvefipvnvaentvivkvtdengvyglgeadgppecmkafseienehkwlnnikea
    vigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmggaq
    kaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeivay
    lrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqklaa
    aintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmph
    nwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpgl
    gielniefveqvtghkf
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >3mqtT (T:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtT (T:)
    anivsvefipvnvasentvivkvtdengvyglgeadgppecmkafseienehkwlnnike
    avigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmgga
    qkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeiva
    ylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqkla
    aaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmp
    hnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpg
    lgielniefveqvtghkf
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >3mqtU (U:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtU (U:)
    anivsvefipvnvasentvivkvtdengvyglgeadgppecmkafseienehkwlnnike
    avigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmgga
    qkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeiva
    ylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqkla
    aaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmp
    hnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpg
    lgielniefveqvtghkf
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >3mqtV (V:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtV (V:)
    anivsvefipvnvasentvivkvtdengvyglgeadgppecmkafseienehkwlnnike
    avigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmgga
    qkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeiva
    ylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqkla
    aaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmp
    hnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpg
    lgielniefveqvtghkf
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >3mqtW (W:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtW (W:)
    anivsvefipvnvasentvivkvtdengvyglgeadgppecmkafseienehkwlnnike
    avigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmgga
    qkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeiva
    ylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqkla
    aaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmp
    hnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpg
    lgielniefveqvtghkf
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >3mqtX (X:)
    mslganivsvefipvnvaatnwsentvivkvtdengvyglgeadgppecmkafseieneh
    kwlnnikeavigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvp
    ayklmggaqkaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndk
    vsdkeivaylrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhdd
    lighqklaaaintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdice
    hhnaqlmphnwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidga
    ievsdkpglgielniefveqvtghkfeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3mqtX (X:)
    anivsvefipvnvaentvivkvtdengvyglgeadgppecmkafseienehkwlnnikea
    vigrdplefranynrmydttkwigmrglglfaisgidmalydlagkqlgvpayklmggaq
    kaqltpyftlypsvaadatlseiveaykpliakakergakavkvciipndkvsdkeivay
    lrelrevigwdmdmmvdclyrwtdwqkarwtfrqledidlyfieaclqhddlighqklaa
    aintrlcgaemsttrfeaqewlektgisvvqsdynrcggvtellrimdicehhnaqlmph
    nwktgitaaaarhfgivchiseyveylhpdfwngtltqqltlnepkiidgaievsdkpgl
    gielniefveqvtghkf