PDB entry 3mqr

View 3mqr on RCSB PDB site
Description: Crystal Structure of the USP7:HdmX(AHSS) complex
Deposited on 2010-04-28, released 2010-08-25
The last revision was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: HAUSP, USP7
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: HdmX Peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MQR
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mqrA (A:)
    gshtaeedmeddtswrseatfqftverfsrlsesvlsppcfvrnlpwkimvmprfypdrp
    hqksvgfflqcnaesdstswschaqavlkiinyrddeksfsrrishlffhkendwgfsnf
    mawsevtdpekgfidddkvtfevfvqadaphgvaw
    

    Sequence, based on observed residues (ATOM records):
    >3mqrA (A:)
    tswrseatfqftverfsrlsesvlsppcfvrnlpwkimvmprfqksvgfflqcnaesdst
    swschaqavlkiinyrddeksfsrrishlffhkendwgfsnfmawsevtdpekgfidddk
    vtfevfvqadaphgvaw
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mqrB (B:)
    ldlahssesq
    

    Sequence, based on observed residues (ATOM records):
    >3mqrB (B:)
    ahss