PDB entry 3mqq

View 3mqq on RCSB PDB site
Description: the crystal structure of the pas domain in complex with ethanol of a transcriptional regulator in the luxr family from burkholderia thailandensis to 1.65a
Deposited on 2010-04-28, released 2010-06-23
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, LuxR family
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I2609
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcriptional regulator, LuxR family
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: BTH_I2609
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EOH, EDO, NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mqqA (A:)
    paidyktafhlapiglvlsrdrviedcndelaaifrcaradligrsfevlypssdeferi
    gerispvmiahgsyaddrimkraggelfwchvtgraldrtaplaagvwtfedlsatrrva
    

    Sequence, based on observed residues (ATOM records):
    >3mqqA (A:)
    idyktafhlapiglvlsrdrviedcndelaaifrcaradligrsfevlypssdeferige
    rispvmiahgsyaddrimkraggelfwchvtgraldrtaplaagvwtfedlsa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mqqB (B:)
    paidyktafhlapiglvlsrdrviedcndelaaifrcaradligrsfevlypssdeferi
    gerispvmiahgsyaddrimkraggelfwchvtgraldrtaplaagvwtfedlsatrrva
    

    Sequence, based on observed residues (ATOM records):
    >3mqqB (B:)
    idyktafhlapiglvlsrdrviedcndelaaifrcaradligrsfevlypssdeferige
    rispvmiahgsyaddrimkraggelfwchvtgraldrtaplaagvwtfedlsatrrva