PDB entry 3mqp

View 3mqp on RCSB PDB site
Description: Crystal Structure of human BFL-1 in complex with NOXA BH3 peptide, Northeast Structural Genomics Consortium Target HR2930
Deposited on 2010-04-28, released 2010-06-02
The last revision was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.182
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bcl-2-related protein a1
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL2A1, BCL2L5, BFL1, GRS, HBPA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Phorbol-12-myristate-13-acetate-induced protein 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mqpA (A:)
    mghhhhhhshmtdcefgyiyrlaqdylqcvlqipqpgsgpsktsrvlqnvafsvqkevek
    nlkscldnvnvvsvdtartlfnqvmekefedgiinwgrivtifafegilikkllrqqiap
    dvdtykeisyfvaefimnntgewirqnggwengfvkkfepk
    

    Sequence, based on observed residues (ATOM records):
    >3mqpA (A:)
    tdcefgyiyrlaqdylqcvlqipqpgsgpsktsrvlqnvafsvqkeveknlkscldnvnv
    vsvdtartlfnqvmekefedgiinwgrivtifafegilikkllrqqiapdvdtykeisyf
    vaefimnntgewirqnggwengfvkkfepk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3mqpB (B:)
    aelevecatqlrrfgdklnfrqkll