PDB entry 3mqm
View 3mqm on RCSB PDB site
Description: Crystal Structure of the Bromodomain of human ASH1L
Class: transferase
Keywords: ASH1L, Ash1, KIAA1420, Absent small and homeotic disks protein 1 homolog, Lysine N-methyltransferase 2H, KMT2H, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on
2010-04-28, released
2010-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated
2012-04-11, with a file datestamp of
2012-04-06.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.207
AEROSPACI score: 0.33
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Probable histone-lysine N-methyltransferase ASH1L
Species: Homo sapiens [TaxId:9606]
Gene: ASH1L, KIAA1420, KMT2H
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3mqma1, d3mqma2 - Chain 'B':
Compound: Probable histone-lysine N-methyltransferase ASH1L
Species: Homo sapiens [TaxId:9606]
Gene: ASH1L, KIAA1420, KMT2H
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3mqmb1, d3mqmb2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3mqmA (A:)
smevaraarlaqifkeicdgiisykdssrqalaapllnlppkkknadyyekisdpldlit
iekqiltgyyktveafdadmlkvfrnaekyygrkspvgrdvcrlrkayynarheasaqid
eivget
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3mqmB (B:)
smevaraarlaqifkeicdgiisykdssrqalaapllnlppkkknadyyekisdpldlit
iekqiltgyyktveafdadmlkvfrnaekyygrkspvgrdvcrlrkayynarheasaqid
eivget