PDB entry 3mqm

View 3mqm on RCSB PDB site
Description: Crystal Structure of the Bromodomain of human ASH1L
Class: transferase
Keywords: ASH1L, Ash1, KIAA1420, Absent small and homeotic disks protein 1 homolog, Lysine N-methyltransferase 2H, KMT2H, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2010-04-28, released 2010-05-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.207
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable histone-lysine N-methyltransferase ASH1L
    Species: Homo sapiens [TaxId:9606]
    Gene: ASH1L, KIAA1420, KMT2H
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NR48 (2-125)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d3mqma_
  • Chain 'B':
    Compound: Probable histone-lysine N-methyltransferase ASH1L
    Species: Homo sapiens [TaxId:9606]
    Gene: ASH1L, KIAA1420, KMT2H
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NR48 (2-125)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d3mqmb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mqmA (A:)
    smevaraarlaqifkeicdgiisykdssrqalaapllnlppkkknadyyekisdpldlit
    iekqiltgyyktveafdadmlkvfrnaekyygrkspvgrdvcrlrkayynarheasaqid
    eivget
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mqmB (B:)
    smevaraarlaqifkeicdgiisykdssrqalaapllnlppkkknadyyekisdpldlit
    iekqiltgyyktveafdadmlkvfrnaekyygrkspvgrdvcrlrkayynarheasaqid
    eivget