PDB entry 3mqh

View 3mqh on RCSB PDB site
Description: crystal structure of the 3-N-acetyl transferase WlbB from Bordetella petrii in complex with CoA and UDP-3-amino-2-acetamido-2,3-dideoxy glucuronic acid
Deposited on 2010-04-28, released 2010-05-12
The last revision was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.176
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipopolysaccharides biosynthesis acetyltransferase
    Species: Bordetella petrii [TaxId:340100]
    Gene: Bpet4817, wlbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9IH93 (2-191)
      • expression tag (1)
  • Chain 'B':
    Compound: Lipopolysaccharides biosynthesis acetyltransferase
    Species: Bordetella petrii [TaxId:340100]
    Gene: Bpet4817, wlbB
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Lipopolysaccharides biosynthesis acetyltransferase
    Species: Bordetella petrii [TaxId:340100]
    Gene: Bpet4817, wlbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9IH93 (2-191)
      • expression tag (0-1)
  • Chain 'D':
    Compound: Lipopolysaccharides biosynthesis acetyltransferase
    Species: Bordetella petrii [TaxId:340100]
    Gene: Bpet4817, wlbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9IH93 (2-191)
      • expression tag (0-1)
  • Chain 'E':
    Compound: Lipopolysaccharides biosynthesis acetyltransferase
    Species: Bordetella petrii [TaxId:340100]
    Gene: Bpet4817, wlbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot A9IH93 (2-191)
      • expression tag (0-1)
  • Chain 'F':
    Compound: Lipopolysaccharides biosynthesis acetyltransferase
    Species: Bordetella petrii [TaxId:340100]
    Gene: Bpet4817, wlbB
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MJZ, COA, EDO, NA, PO4, PE4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mqhA (A:)
    ghmatihptaivdegarigahsriwhwvhicggaeigegcslgqnvfvgnrvrignrvki
    qnnvsvydnvfleddvfcgpsmvftnvynpraaierkseyrdtivrqgatlganctvvcg
    atigryafvgagavvnkdvpdfalvvgvparqigwmsrhgeqldlplrgnaeatcphtge
    ryiltdgvcrla
    

    Sequence, based on observed residues (ATOM records):
    >3mqhA (A:)
    hmatihptaivdegarigahsriwhwvhicggaeigegcslgqnvfvgnrvrignrvkiq
    nnvsvydnvfleddvfcgpsmvftnvynpraaierkseyrdtivrqgatlganctvvcga
    tigryafvgagavvnkdvpdfalvvgvparqigwmsrhgeqldlplrgnaeatcphtger
    yiltdgvcrla
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mqhB (B:)
    ghmatihptaivdegarigahsriwhwvhicggaeigegcslgqnvfvgnrvrignrvki
    qnnvsvydnvfleddvfcgpsmvftnvynpraaierkseyrdtivrqgatlganctvvcg
    atigryafvgagavvnkdvpdfalvvgvparqigwmsrhgeqldlplrgnaeatcphtge
    ryiltdgvcrla
    

    Sequence, based on observed residues (ATOM records):
    >3mqhB (B:)
    atihptaivdegarigahsriwhwvhicggaeigegcslgqnvfvgnrvrignrvkiqnn
    vsvydnvfleddvfcgpsmvftnvynpraaierkseyrdtivrqgatlganctvvcgati
    gryafvgagavvnkdvpdfalvvgvparqigwmsrhgeqldlplrgnaeatcphtgeryi
    ltdgvcrla
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >3mqhC (C:)
    ghmatihptaivdegarigahsriwhwvhicggaeigegcslgqnvfvgnrvrignrvki
    qnnvsvydnvfleddvfcgpsmvftnvynpraaierkseyrdtivrqgatlganctvvcg
    atigryafvgagavvnkdvpdfalvvgvparqigwmsrhgeqldlplrgnaeatcphtge
    ryiltdgvcrla
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3mqhD (D:)
    ghmatihptaivdegarigahsriwhwvhicggaeigegcslgqnvfvgnrvrignrvki
    qnnvsvydnvfleddvfcgpsmvftnvynpraaierkseyrdtivrqgatlganctvvcg
    atigryafvgagavvnkdvpdfalvvgvparqigwmsrhgeqldlplrgnaeatcphtge
    ryiltdgvcrla
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >3mqhE (E:)
    ghmatihptaivdegarigahsriwhwvhicggaeigegcslgqnvfvgnrvrignrvki
    qnnvsvydnvfleddvfcgpsmvftnvynpraaierkseyrdtivrqgatlganctvvcg
    atigryafvgagavvnkdvpdfalvvgvparqigwmsrhgeqldlplrgnaeatcphtge
    ryiltdgvcrla
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mqhF (F:)
    ghmatihptaivdegarigahsriwhwvhicggaeigegcslgqnvfvgnrvrignrvki
    qnnvsvydnvfleddvfcgpsmvftnvynpraaierkseyrdtivrqgatlganctvvcg
    atigryafvgagavvnkdvpdfalvvgvparqigwmsrhgeqldlplrgnaeatcphtge
    ryiltdgvcrla
    

    Sequence, based on observed residues (ATOM records):
    >3mqhF (F:)
    matihptaivdegarigahsriwhwvhicggaeigegcslgqnvfvgnrvrignrvkiqn
    nvsvydnvfleddvfcgpsmvftnvynpraaierkseyrdtivrqgatlganctvvcgat
    igryafvgagavvnkdvpdfalvvgvparqigwmsrhgeqldlplrgnaeatcphtgery
    iltdgvcrla