PDB entry 3mqd

View 3mqd on RCSB PDB site
Description: Crystal structure of beta-ketoacyl synthase from brucella melitensis with FOL 0758, (1-methyl-1h-indazol-3-yl) methanol
Class: transferase
Keywords: SSGCID, ALS COLLABORATIVE CRYSTALLOGRAPHY, BETA-KETOACYL SYNTHASE, BRUCELLA MELITENSIS, FRAGMENTS OF LIFE, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2010-04-28, released 2010-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.113
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-ketoacyl synthase
    Species: Brucella melitensis biovar Abortus [TaxId:359391]
    Gene: fabB, BAB1_2173
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mqda1, d3mqda2
  • Heterogens: NA, CL, 3MQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mqdA (A:)
    mahhhhhhmgtleaqtqgpgsmrrvvvtgmgivssigsnteevtaslreaksgisraeey
    aelgfrcqvhgapdidieslvdrramrfhgrgtawnhiamdqaiadaglteeevsnertg
    iimgsggpstrtivdsaditrekgpkrvgpfavpkamsstasatlatffkikginysiss
    acatsnhcignayemiqygkqdrmfaggcedldwtlsvlfdamgamsskyndtpstasra
    ydknrdgfviaggagvlvledletalargakiygeivgygatsdgydmvapsgegaircm
    kmalstvtskidyinphatstpagdapeieairqifgagdvcppiaatksltghslgatg
    vqeaiysllmmqnnficesahieeldpafadmpivrkridnvqlntvlsnsfgfggtnat
    lvfqryqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mqdA (A:)
    mrrvvvtgmgivssigsnteevtaslreaksgisraeeyaelgfrcqvhgapdidieslv
    drramrfhgrgtawnhiamdqaiadaglteeevsnertgiimgsggpstrtivdsaditr
    ekgpkrvgpfavpkamsstasatlatffkikginysissacatsnhcignayemiqygkq
    drmfaggcedldwtlsvlfdamgamsskyndtpstasraydknrdgfviaggagvlvled
    letalargakiygeivgygatsdgydmvapsgegaircmkmalstvtskidyinphatst
    pagdapeieairqifgagdvcppiaatksltghslgatgvqeaiysllmmqnnficesah
    ieeldpafadmpivrkridnvqlntvlsnsfgfggtnatlvfqryqg