PDB entry 3mqb

View 3mqb on RCSB PDB site
Description: Crystal Structure of Ectodomain of BST-2/Tetherin/CD317 (C2)
Deposited on 2010-04-27, released 2010-10-27
The last revision was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.258
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mqbA (A:)
    agfsmdkanseacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mqbA (A:)
    seacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalmasldaekaqg
    qkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mqbB (B:)
    agfsmdkanseacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mqbB (B:)
    seacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalmasldaekaqg
    qkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyyp
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mqbE (E:)
    agfsmdkanseacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mqbE (E:)
    seacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalmasldaekaqg
    qkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyyp
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mqbF (F:)
    agfsmdkanseacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mqbF (F:)
    seacrdglravmecrnvthllqqelteaqkgfqdveaqaatcnhtvmalmasldaekaqg
    qkkveelegeittlnhklqdasaeverlrrenqvlsvriadk