PDB entry 3mq9

View 3mq9 on RCSB PDB site
Description: crystal structure of ectodomain mutant of bst-2/tetherin/cd317 fused to mbp
Deposited on 2010-04-27, released 2010-10-27
The last revision was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein
    Species: Homo sapiens [TaxId:9606]
    Gene: malE, b4034, JW3994, BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (Start-382)
    • Uniprot Q10589 (397-470)
      • expression tag (383-396)
      • engineered mutation (422)
  • Chain 'B':
    Compound: Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein
    Species: Homo sapiens [TaxId:9606]
    Gene: malE, b4034, JW3994, BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (Start-382)
    • Uniprot Q10589 (397-470)
      • expression tag (383-396)
      • engineered mutation (422)
  • Chain 'C':
    Compound: Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein
    Species: Homo sapiens [TaxId:9606]
    Gene: malE, b4034, JW3994, BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (Start-382)
    • Uniprot Q10589 (397-470)
      • expression tag (383-396)
      • engineered mutation (422)
  • Chain 'D':
    Compound: Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein
    Species: Homo sapiens [TaxId:9606]
    Gene: malE, b4034, JW3994, BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (Start-382)
    • Uniprot Q10589 (397-470)
      • expression tag (383-396)
      • engineered mutation (422)
  • Chain 'E':
    Compound: Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein
    Species: Homo sapiens [TaxId:9606]
    Gene: malE, b4034, JW3994, BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (Start-382)
    • Uniprot Q10589 (397-470)
      • expression tag (383-396)
      • engineered mutation (422)
  • Chain 'F':
    Compound: Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein
    Species: Homo sapiens [TaxId:9606]
    Gene: malE, b4034, JW3994, BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (Start-382)
    • Uniprot Q10589 (397-470)
      • expression tag (383-396)
      • engineered mutation (422)
  • Chain 'G':
    Compound: Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein
    Species: Homo sapiens [TaxId:9606]
    Gene: malE, b4034, JW3994, BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (Start-382)
    • Uniprot Q10589 (397-470)
      • expression tag (383-396)
      • engineered mutation (422)
  • Chain 'H':
    Compound: Bone marrow stromal antigen 2 fused to Maltose-binding periplasmic protein
    Species: Homo sapiens [TaxId:9606]
    Gene: malE, b4034, JW3994, BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (Start-382)
    • Uniprot Q10589 (397-470)
      • expression tag (383-396)
      • engineered mutation (422)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mq9A (A:)
    mntihhhhhhntsmkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleek
    fpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliay
    piavealsliynkdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadgg
    yafkyengkydikdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamti
    ngpwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenyllt
    degleavnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrta
    vinaasgrqtvdealkdaqtritaardglravmearnvthllqqelteaqkgfqdveaqa
    atanhtvmalmasldaekaqgqkkveelegeittlnhklqdasaeverlrr
    

    Sequence, based on observed residues (ATOM records):
    >3mq9A (A:)
    egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa
    hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp
    nppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv
    dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnyg
    vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
    lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd
    aqtritaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldae
    kaqgqkkveelegeittlnhklqdasaeverlrr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mq9B (B:)
    mntihhhhhhntsmkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleek
    fpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliay
    piavealsliynkdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadgg
    yafkyengkydikdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamti
    ngpwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenyllt
    degleavnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrta
    vinaasgrqtvdealkdaqtritaardglravmearnvthllqqelteaqkgfqdveaqa
    atanhtvmalmasldaekaqgqkkveelegeittlnhklqdasaeverlrr
    

    Sequence, based on observed residues (ATOM records):
    >3mq9B (B:)
    egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa
    hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp
    nppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv
    dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnyg
    vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
    lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd
    aqtritaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldae
    kaqgqkkveelegeittlnhklqdasaeverlrr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mq9C (C:)
    mntihhhhhhntsmkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleek
    fpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliay
    piavealsliynkdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadgg
    yafkyengkydikdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamti
    ngpwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenyllt
    degleavnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrta
    vinaasgrqtvdealkdaqtritaardglravmearnvthllqqelteaqkgfqdveaqa
    atanhtvmalmasldaekaqgqkkveelegeittlnhklqdasaeverlrr
    

    Sequence, based on observed residues (ATOM records):
    >3mq9C (C:)
    egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa
    hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp
    nppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv
    dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnyg
    vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
    lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd
    aqtritaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldae
    kaqgqkkveelegeittlnhklqdasaeverlrr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mq9D (D:)
    mntihhhhhhntsmkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleek
    fpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliay
    piavealsliynkdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadgg
    yafkyengkydikdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamti
    ngpwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenyllt
    degleavnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrta
    vinaasgrqtvdealkdaqtritaardglravmearnvthllqqelteaqkgfqdveaqa
    atanhtvmalmasldaekaqgqkkveelegeittlnhklqdasaeverlrr
    

    Sequence, based on observed residues (ATOM records):
    >3mq9D (D:)
    egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa
    hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp
    nppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv
    dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnyg
    vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
    lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd
    aqtritaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldae
    kaqgqkkveelegeittlnhklqdasaeverlrr
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mq9E (E:)
    mntihhhhhhntsmkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleek
    fpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliay
    piavealsliynkdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadgg
    yafkyengkydikdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamti
    ngpwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenyllt
    degleavnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrta
    vinaasgrqtvdealkdaqtritaardglravmearnvthllqqelteaqkgfqdveaqa
    atanhtvmalmasldaekaqgqkkveelegeittlnhklqdasaeverlrr
    

    Sequence, based on observed residues (ATOM records):
    >3mq9E (E:)
    egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa
    hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp
    nppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv
    dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnyg
    vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
    lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd
    aqtritaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldae
    kaqgqkkveelegeittlnhklqdasaeverlrr
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mq9F (F:)
    mntihhhhhhntsmkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleek
    fpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliay
    piavealsliynkdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadgg
    yafkyengkydikdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamti
    ngpwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenyllt
    degleavnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrta
    vinaasgrqtvdealkdaqtritaardglravmearnvthllqqelteaqkgfqdveaqa
    atanhtvmalmasldaekaqgqkkveelegeittlnhklqdasaeverlrr
    

    Sequence, based on observed residues (ATOM records):
    >3mq9F (F:)
    egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa
    hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp
    nppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv
    dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnyg
    vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
    lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd
    aqtritaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldae
    kaqgqkkveelegeittlnhklqdasaeverlrr
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3mq9G (G:)
    mntihhhhhhntsmkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleek
    fpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliay
    piavealsliynkdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadgg
    yafkyengkydikdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamti
    ngpwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenyllt
    degleavnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrta
    vinaasgrqtvdealkdaqtritaardglravmearnvthllqqelteaqkgfqdveaqa
    atanhtvmalmasldaekaqgqkkveelegeittlnhklqdasaeverlrr
    

    Sequence, based on observed residues (ATOM records):
    >3mq9G (G:)
    egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa
    hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp
    nppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv
    dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnyg
    vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
    lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd
    aqtritaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldae
    kaqgqkkveelegeittlnhklqdasaeverlrr
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3mq9H (H:)
    mntihhhhhhntsmkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleek
    fpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliay
    piavealsliynkdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadgg
    yafkyengkydikdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamti
    ngpwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenyllt
    degleavnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrta
    vinaasgrqtvdealkdaqtritaardglravmearnvthllqqelteaqkgfqdveaqa
    atanhtvmalmasldaekaqgqkkveelegeittlnhklqdasaeverlrr
    

    Sequence, based on observed residues (ATOM records):
    >3mq9H (H:)
    egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa
    hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp
    nppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv
    dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnyg
    vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
    lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd
    aqtritaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldae
    kaqgqkkveelegeittlnhklqdasaeverlrr