PDB entry 3mq7

View 3mq7 on RCSB PDB site
Description: Crystal Structure of Ectodomain Mutant of BST-2/Tetherin/CD317
Deposited on 2010-04-27, released 2010-10-27
The last revision was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.237
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10589
      • engineered mutation (12)
      • engineered mutation (22)
      • engineered mutation (50)
  • Chain 'B':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10589
      • engineered mutation (12)
      • engineered mutation (22)
      • engineered mutation (50)
  • Chain 'C':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10589
      • engineered mutation (12)
      • engineered mutation (22)
      • engineered mutation (50)
  • Chain 'D':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10589
      • engineered mutation (12)
      • engineered mutation (22)
      • engineered mutation (50)
  • Chain 'E':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10589
      • engineered mutation (12)
      • engineered mutation (22)
      • engineered mutation (50)
  • Chain 'F':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10589
      • engineered mutation (12)
      • engineered mutation (22)
      • engineered mutation (50)
  • Chain 'G':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10589
      • engineered mutation (12)
      • engineered mutation (22)
      • engineered mutation (50)
  • Chain 'H':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10589
      • engineered mutation (12)
      • engineered mutation (22)
      • engineered mutation (50)
  • Chain 'I':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10589
      • engineered mutation (12)
      • engineered mutation (22)
      • engineered mutation (50)
  • Chain 'J':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10589
      • engineered mutation (12)
      • engineered mutation (22)
      • engineered mutation (50)
  • Chain 'K':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10589
      • engineered mutation (12)
      • engineered mutation (22)
      • engineered mutation (50)
  • Chain 'L':
    Compound: Bone marrow stromal antigen 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10589
      • engineered mutation (12)
      • engineered mutation (22)
      • engineered mutation (50)
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mq7A (A:)
    agfsmdkanseaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mq7A (A:)
    eaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldaekaqgq
    kkveelegeittlnhklqdasaeverlrrenqvlsvria
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mq7B (B:)
    agfsmdkanseaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mq7B (B:)
    eaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldaekaqgq
    kkveelegeittlnhklqdasaeverlrrenqvlsvria
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mq7C (C:)
    agfsmdkanseaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mq7C (C:)
    eaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldaekaqgq
    kkveelegeittlnhklqdasaeverlrrenqvlsvria
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mq7D (D:)
    agfsmdkanseaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mq7D (D:)
    eaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldaekaqgq
    kkveelegeittlnhklqdasaeverlrrenqvlsvria
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mq7E (E:)
    agfsmdkanseaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mq7E (E:)
    eaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldaekaqgq
    kkveelegeittlnhklqdasaeverlrrenqvlsvria
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3mq7F (F:)
    agfsmdkanseaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mq7F (F:)
    eaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldaekaqgq
    kkveelegeittlnhklqdasaeverlrrenqvlsvria
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3mq7G (G:)
    agfsmdkanseaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mq7G (G:)
    eaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldaekaqgq
    kkveelegeittlnhklqdasaeverlrrenqvlsvria
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3mq7H (H:)
    agfsmdkanseaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mq7H (H:)
    eaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldaekaqgq
    kkveelegeittlnhklqdasaeverlrrenqvlsvria
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >3mq7I (I:)
    agfsmdkanseaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mq7I (I:)
    eaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldaekaqgq
    kkveelegeittlnhklqdasaeverlrrenqvlsvria
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >3mq7J (J:)
    agfsmdkanseaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mq7J (J:)
    eaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldaekaqgq
    kkveelegeittlnhklqdasaeverlrrenqvlsvria
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >3mq7K (K:)
    agfsmdkanseaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mq7K (K:)
    eaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldaekaqgq
    kkveelegeittlnhklqdasaeverlrrenqvlsvria
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >3mq7L (L:)
    agfsmdkanseaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalma
    sldaekaqgqkkveelegeittlnhklqdasaeverlrrenqvlsvriadkkyypssqds
    s
    

    Sequence, based on observed residues (ATOM records):
    >3mq7L (L:)
    eaardglravmearnvthllqqelteaqkgfqdveaqaatanhtvmalmasldaekaqgq
    kkveelegeittlnhklqdasaeverlrrenqvlsvria