PDB entry 3mq6

View 3mq6 on RCSB PDB site
Description: Domain swapped SgrAI with DNA and calcium bound
Deposited on 2010-04-27, released 2010-11-10
The last revision was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SgraIR restriction enzyme
    Species: Streptomyces griseus [TaxId:1911]
    Gene: sgraIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F6L0 (0-337)
      • cloning artifact (61)
  • Chain 'B':
    Compound: SgraIR restriction enzyme
    Species: Streptomyces griseus [TaxId:1911]
    Gene: sgraIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F6L0 (0-337)
      • cloning artifact (61)
  • Chain 'C':
    Compound: SgraIR restriction enzyme
    Species: Streptomyces griseus [TaxId:1911]
    Gene: sgraIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F6L0 (0-337)
      • cloning artifact (61)
  • Chain 'D':
    Compound: SgraIR restriction enzyme
    Species: Streptomyces griseus [TaxId:1911]
    Gene: sgraIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F6L0 (0-337)
      • cloning artifact (61)
  • Chain 'E':
    Compound: SgraIR restriction enzyme
    Species: Streptomyces griseus [TaxId:1911]
    Gene: sgraIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F6L0 (0-337)
      • cloning artifact (61)
  • Chain 'F':
    Compound: SgraIR restriction enzyme
    Species: Streptomyces griseus [TaxId:1911]
    Gene: sgraIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F6L0 (0-337)
      • cloning artifact (61)
  • Chain 'G':
    Compound: SgraIR restriction enzyme
    Species: Streptomyces griseus [TaxId:1911]
    Gene: sgraIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F6L0 (0-337)
      • cloning artifact (61)
  • Chain 'H':
    Compound: SgraIR restriction enzyme
    Species: Streptomyces griseus [TaxId:1911]
    Gene: sgraIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9F6L0 (0-337)
      • cloning artifact (61)
  • Chain 'K':
    Compound: DNA (5'-d(*ap*ap*gp*tp*cp*cp*ap*cp*cp*gp*gp*tp*gp*gp*ap*cp*t)-3')
    Species: synthetic, synthetic
  • Chain 'L':
    Compound: DNA (5'-d(*ap*ap*gp*tp*cp*cp*ap*cp*cp*gp*gp*tp*gp*gp*ap*cp*t)-3')
    Species: synthetic, synthetic
  • Chain 'M':
    Compound: DNA (5'-d(*ap*ap*gp*tp*cp*cp*ap*cp*cp*gp*gp*tp*gp*gp*ap*cp*t)-3')
    Species: synthetic, synthetic
  • Chain 'N':
    Compound: DNA (5'-d(*ap*ap*gp*tp*cp*cp*ap*cp*cp*gp*gp*tp*gp*gp*ap*cp*t)-3')
    Species: synthetic, synthetic
  • Chain 'O':
    Compound: DNA (5'-d(*ap*ap*gp*tp*cp*cp*ap*cp*cp*gp*gp*tp*gp*gp*ap*cp*t)-3')
    Species: synthetic, synthetic
  • Chain 'P':
    Compound: DNA (5'-d(*ap*ap*gp*tp*cp*cp*ap*cp*cp*gp*gp*tp*gp*gp*ap*cp*t)-3')
    Species: synthetic, synthetic
  • Chain 'Q':
    Compound: DNA (5'-d(*ap*ap*gp*tp*cp*cp*ap*cp*cp*gp*gp*tp*gp*gp*ap*cp*t)-3')
    Species: synthetic, synthetic
  • Chain 'R':
    Compound: DNA (5'-d(*ap*ap*gp*tp*cp*cp*ap*cp*cp*gp*gp*tp*gp*gp*ap*cp*t)-3')
    Species: synthetic, synthetic
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mq6A (A:)
    pftysieatrnlatterciqdirnapvrnrstqfqlaqqnmlaytfgevipgfasaging
    mdyrdvigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslm
    vgegwrsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglg
    lptstpdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavaf
    krslrsdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglae
    grsavhrairelyvpptaadlarrffaflnermelvng
    

    Sequence, based on observed residues (ATOM records):
    >3mq6A (A:)
    pftysieatrnlatterciqdirrstqfqlaqqnmlaytfgevipgfasagingmdyrdv
    igrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslmvgegwr
    sqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglglptstp
    dlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavafkrslrs
    drlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglaegrsavh
    rairelyvpptaadlarrffaflnermelvng
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3mq6B (B:)
    pftysieatrnlatterciqdirnapvrnrstqfqlaqqnmlaytfgevipgfasaging
    mdyrdvigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslm
    vgegwrsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglg
    lptstpdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavaf
    krslrsdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglae
    grsavhrairelyvpptaadlarrffaflnermelvng
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3mq6C (C:)
    pftysieatrnlatterciqdirnapvrnrstqfqlaqqnmlaytfgevipgfasaging
    mdyrdvigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslm
    vgegwrsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglg
    lptstpdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavaf
    krslrsdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglae
    grsavhrairelyvpptaadlarrffaflnermelvng
    

    Sequence, based on observed residues (ATOM records):
    >3mq6C (C:)
    pftysieatrnlatterciqdirnapvrnrstqfqlaqqnmlaytfgevipgfasaging
    mdyrdvigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslm
    vgegwrsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglg
    lptstpdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavaf
    krslrsdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglas
    avhrairelyvpptaadlarrffaflnermelvng
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3mq6D (D:)
    pftysieatrnlatterciqdirnapvrnrstqfqlaqqnmlaytfgevipgfasaging
    mdyrdvigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslm
    vgegwrsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglg
    lptstpdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavaf
    krslrsdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglae
    grsavhrairelyvpptaadlarrffaflnermelvng
    

    Sequence, based on observed residues (ATOM records):
    >3mq6D (D:)
    pftysieatrnlatterciqdirnrstqfqlaqqnmlaytfgevipgfasagingmdyrd
    vigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslmvgegw
    rsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglglptst
    pdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavafkrslr
    sdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglaegrsav
    hrairelyvpptaadlarrffaflnermelvng
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3mq6E (E:)
    pftysieatrnlatterciqdirnapvrnrstqfqlaqqnmlaytfgevipgfasaging
    mdyrdvigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslm
    vgegwrsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglg
    lptstpdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavaf
    krslrsdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglae
    grsavhrairelyvpptaadlarrffaflnermelvng
    

    Sequence, based on observed residues (ATOM records):
    >3mq6E (E:)
    pftysieatrnlatterciqdirnrstqfqlaqqnmlaytfgevipgfasagingmdyrd
    vigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslmvgegw
    rsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglglptst
    pdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavafkrslr
    sdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglaegrsav
    hrairelyvpptaadlarrffaflnermelvng
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >3mq6F (F:)
    pftysieatrnlatterciqdirnapvrnrstqfqlaqqnmlaytfgevipgfasaging
    mdyrdvigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslm
    vgegwrsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglg
    lptstpdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavaf
    krslrsdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglae
    grsavhrairelyvpptaadlarrffaflnermelvng
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3mq6G (G:)
    pftysieatrnlatterciqdirnapvrnrstqfqlaqqnmlaytfgevipgfasaging
    mdyrdvigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslm
    vgegwrsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglg
    lptstpdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavaf
    krslrsdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglae
    grsavhrairelyvpptaadlarrffaflnermelvng
    

    Sequence, based on observed residues (ATOM records):
    >3mq6G (G:)
    pftysieatrnlatterciqdirnapvrnrstqfqlaqqnmlaytfgevipgfasaging
    mdyrdvigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslm
    vgegwrsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglg
    lptstpdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavaf
    krslrsdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglae
    gvhrairelyvpptaadlarrffaflnermelvng
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3mq6H (H:)
    pftysieatrnlatterciqdirnapvrnrstqfqlaqqnmlaytfgevipgfasaging
    mdyrdvigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslm
    vgegwrsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglg
    lptstpdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavaf
    krslrsdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglae
    grsavhrairelyvpptaadlarrffaflnermelvng
    

    Sequence, based on observed residues (ATOM records):
    >3mq6H (H:)
    pftysieatrnlatterciqdirnapvrnrstqfqlaqqnmlaytfgevipgfasaging
    mdyrdvigrpvenavtegthffrddfrvdsnakakvagdifeivssavmwncaarwnslm
    vgegwrsqprysrptlspsprrqvavlnlprsfdwvsllvpesqevieefraglrkdglg
    lptstpdlavvvlpeefqndemwreeiagltrpnqillsgayqrlqgrvqpgeislavaf
    krslrsdrlyqplyeanvmqlllegklgapkvefevhtlapegtnafvtyeaaslyglae
    gavhrairelyvpptaadlarrffaflnermelvng
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.