PDB entry 3mq2

View 3mq2 on RCSB PDB site
Description: Crystal Structure of 16S rRNA Methyltranferase KamB
Deposited on 2010-04-27, released 2010-12-08
The last revision was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.176
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16S rRNA methyltransferase
    Species: Streptomyces sp. DSM 40477 [TaxId:265180]
    Gene: kamb
    Database cross-references and differences (RAF-indexed):
    • PDB 3MQ2 (3-217)
  • Chain 'B':
    Compound: 16S rRNA methyltransferase
    Species: Streptomyces sp. DSM 40477 [TaxId:265180]
    Gene: kamb
    Database cross-references and differences (RAF-indexed):
    • PDB 3MQ2 (3-217)
  • Heterogens: SAH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mq2A (A:)
    mgsmrrvvgkrvqefsdaefeqlrsqyddvvldvgtgdgkhpykvarqnpsrlvvaldad
    ksrmekisakaaakpakgglpnllylwataerlpplsgvgelhvlmpwgsllrgvlgssp
    emlrgmaavcrpgasflvalnlhawrpsvpevgehpeptpdsadewlapryaeagwklad
    crylepeevagletswtrrlhssrdrfdvlaltgtisp
    

    Sequence, based on observed residues (ATOM records):
    >3mq2A (A:)
    mrrvvgkrvqefsdaefeqlrsqyddvvldvgtgdgkhpykvarqnpsrlvvaldadksr
    mekisakaaakpakgglpnllylwataerlpplsgvgelhvlmpwgsllrgvlgsspeml
    rgmaavcrpgasflvalnlhawrpsvpevgehpeptpdsadewlapryaeagwkladcry
    lepeevagletswtrrlhssrdrfdvlaltgtisp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mq2B (B:)
    mgsmrrvvgkrvqefsdaefeqlrsqyddvvldvgtgdgkhpykvarqnpsrlvvaldad
    ksrmekisakaaakpakgglpnllylwataerlpplsgvgelhvlmpwgsllrgvlgssp
    emlrgmaavcrpgasflvalnlhawrpsvpevgehpeptpdsadewlapryaeagwklad
    crylepeevagletswtrrlhssrdrfdvlaltgtisp
    

    Sequence, based on observed residues (ATOM records):
    >3mq2B (B:)
    mrrvvgkrvqefsdaefeqlrsqyddvvldvgtgdgkhpykvarqnpsrlvvaldadksr
    mekisakaaakpakgglpnllylwataerlpplsgvgelhvlmpwgsllrgvlgsspeml
    rgmaavcrpgasflvalnlhawrpsvpevgehpeptpdsadewlapryaeagwkladcry
    lepeevagletswtrrlhssrdrfdvlaltgtisp