PDB entry 3mq0

View 3mq0 on RCSB PDB site
Description: Crystal Structure of Agobacterium tumefaciens repressor BlcR
Deposited on 2010-04-27, released 2011-03-30
The last revision was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.188
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional repressor of the blcABC operon
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: AGR_pAT_196, attJ, Atu5136, blcR
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcriptional repressor of the blcABC operon
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: AGR_pAT_196, attJ, Atu5136, blcR
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mq0A (A:)
    mgqrgqvcqgkcmaedqqssqisdtvpalrravrildlvagsprdltaaeltrfldlpks
    sahgllavmteldllarsadgtlrigphslrwangflshldivstfndhlaqrhdldpyt
    vtltvreggevvyigcrnsaqplghtfrigmrlpapftatgkillsdlgpgelrmlfsqf
    pqpltsrsvaglsqleeelaltrargysiddgqiregmlcigaairdysgaasagiaisl
    irseasdekiaylgeelrttanalseklgyrsqkd
    

    Sequence, based on observed residues (ATOM records):
    >3mq0A (A:)
    sqisdtvpalrravrildlvagsprdltaaeltrfldlpsahgllavmteldllarsadg
    tlrigphslrwangflshldivstfndhlaqrhdldpytvtltvreggevvyigcrnhtf
    rigmrlpapftatgkillsdlgpgelrmlfsqfpqpltsrsvaglsqleeelaltrargy
    siddgqiregmlcigaairdysgaasagiaislirseasdekiaylgeelrttanalsek
    lgy
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3mq0B (B:)
    mgqrgqvcqgkcmaedqqssqisdtvpalrravrildlvagsprdltaaeltrfldlpks
    sahgllavmteldllarsadgtlrigphslrwangflshldivstfndhlaqrhdldpyt
    vtltvreggevvyigcrnsaqplghtfrigmrlpapftatgkillsdlgpgelrmlfsqf
    pqpltsrsvaglsqleeelaltrargysiddgqiregmlcigaairdysgaasagiaisl
    irseasdekiaylgeelrttanalseklgyrsqkd
    

    Sequence, based on observed residues (ATOM records):
    >3mq0B (B:)
    sdtvpalrravrildlvagsprdltaaeltrfldlpkssahgllavmteldllarsadgt
    lrigphslrwangflshldivstfndhlaqrhdldpytvtltvreggevvyigcrnsaqp
    htfrigmrlpapftatgkillsdlgpgelrmlfsqfpqpltsrsvaglsqleeelaltra
    rgysiddgqiregmlcigaairdysgaasagiaislirseasdekiaylgeelrttanal
    seklgyrs