PDB entry 3mpz

View 3mpz on RCSB PDB site
Description: Crystal structure of CYTIDINE DEAMINASE from Mycobacterium smegmatis
Class: hydrolase
Keywords: SSGCID, MYCOBACTERIUM SMEGMATIS, CYTIDINE DEAMINASE, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, HYDROLASE
Deposited on 2010-04-27, released 2010-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidine deaminase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: cdd, MSMEG_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QT11 (23-End)
      • expression tag (19-22)
    Domains in SCOPe 2.07: d3mpza1, d3mpza2
  • Chain 'B':
    Compound: Cytidine deaminase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: cdd, MSMEG_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QT11 (23-End)
      • expression tag (22)
    Domains in SCOPe 2.07: d3mpzb1, d3mpzb2
  • Chain 'C':
    Compound: Cytidine deaminase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: cdd, MSMEG_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QT11 (23-End)
      • expression tag (22)
    Domains in SCOPe 2.07: d3mpzc1, d3mpzc2
  • Chain 'D':
    Compound: Cytidine deaminase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: cdd, MSMEG_1673
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QT11 (23-End)
      • expression tag (20-22)
    Domains in SCOPe 2.07: d3mpzd1, d3mpzd2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mpzA (A:)
    mahhhhhhmgtleaqtqgpgsmvnwnalrskaievsrhayapysgfpvgaaalvddgrtv
    tgcnvenvsyglglcaecavvcalhsggggrlvalscvgpdggvlmpcgrcrqvllehgg
    pellidhahgprplrellpdafgpddlgrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpzA (A:)
    gsmvnwnalrskaievsrhayapysgfpvgaaalvddgrtvtgcnvenvsyglglcaeca
    vvcalhsggggrlvalscvgpdggvlmpcgrcrqvllehggpellidhahgprplrellp
    dafgp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mpzB (B:)
    mahhhhhhmgtleaqtqgpgsmvnwnalrskaievsrhayapysgfpvgaaalvddgrtv
    tgcnvenvsyglglcaecavvcalhsggggrlvalscvgpdggvlmpcgrcrqvllehgg
    pellidhahgprplrellpdafgpddlgrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpzB (B:)
    vnwnalrskaievsrhayapysgfpvgaaalvddgrtvtgcnvenvsyglglcaecavvc
    alhsggggrlvalscvgpdggvlmpcgrcrqvllehggpellidhahgprplrellpdaf
    g
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mpzC (C:)
    mahhhhhhmgtleaqtqgpgsmvnwnalrskaievsrhayapysgfpvgaaalvddgrtv
    tgcnvenvsyglglcaecavvcalhsggggrlvalscvgpdggvlmpcgrcrqvllehgg
    pellidhahgprplrellpdafgpddlgrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpzC (C:)
    vnwnalrskaievsrhayapysgfpvgaaalvddgrtvtgcnvenvsyglglcaecavvc
    alhsggggrlvalscvgpdggvlmpcgrcrqvllehggpellidhahgprplrellpdaf
    gpd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mpzD (D:)
    mahhhhhhmgtleaqtqgpgsmvnwnalrskaievsrhayapysgfpvgaaalvddgrtv
    tgcnvenvsyglglcaecavvcalhsggggrlvalscvgpdggvlmpcgrcrqvllehgg
    pellidhahgprplrellpdafgpddlgrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpzD (D:)
    smvnwnalrskaievsrhayapysgfpvgaaalvddgrtvtgcnvenvsyglglcaecav
    vcalhsggggrlvalscvgpdggvlmpcgrcrqvllehggpellidhahgprplrellpd
    af