PDB entry 3mpx

View 3mpx on RCSB PDB site
Description: crystal structure of the dh and ph-1 domains of human fgd5
Deposited on 2010-04-27, released 2010-06-23
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FYVE, RhoGEF and PH domain-containing protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: FGD5, ZFYVE23
    Database cross-references and differences (RAF-indexed):
  • Heterogens: UNX

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3mpxA (A:)
    mhhhhhhssgrenlyfqggqsralviaqellssekayvemlqhlnldfhgavmralddmd
    hegrdtlareelrqglselpaihdlhqgileeleerlsnwesqqkvadvflareqgfdhh
    athilqfdrylgllsenclhsprlaaavrefeqsvqggsqtakhrllrvvqrlfqyqvll
    tdylnnlcpdsaeydntqgalsliskvtdrandsmeqgenlqklvhiehsvrgqgdllqp
    greflkegtlmkvtgknrrprhlflmndvllytypqkdgkyrlkntlavanmkvsrpvme
    kvpyalkietsesclmlsasscaerdewygclsralpedykaqalaafhhsveirerlgv
    slgerpptlvpvthvmmcmncgcdfsltlrrhhchacgkivcrncsrnkyplkylkdrma
    kvcdgcfgelkkrg
    

    Sequence, based on observed residues (ATOM records):
    >3mpxA (A:)
    qsralviaqellssekayvemlqhlnldfhgavmralddmdhedtlareelrqglselpa
    ihdlhqgileeleerlsnwesqqkvadvflareqgfdhhathilqfdrylgllsenclhs
    prlaaavrefeqstakhrllrvvqrlfqyqvlltdylnnlcpdsaeydntqgalsliskv
    tdrandsmeqgenlqklvhiehsvrgqgdllqpgreflkegtlmkvtgknrrprhlflmn
    dvllytypqkdgkyrlkntlavsrpvmekvpyalkietsesclmlsasscaerdewygcl
    sra