PDB entry 3mpw

View 3mpw on RCSB PDB site
Description: Structure of EUTM in 2-D protein membrane
Class: membrane protein
Keywords: Bacterial microcompartment, shell protein, ethanolamine ammonia lyase, carboxysome, MEMBRANE PROTEIN
Deposited on 2010-04-27, released 2011-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.253
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABF4 (Start-96)
      • expression tag (97-99)
    Domains in SCOPe 2.07: d3mpwa1, d3mpwa2
  • Chain 'B':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABF4 (Start-96)
      • expression tag (97)
    Domains in SCOPe 2.07: d3mpwb1, d3mpwb2
  • Chain 'C':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpwc_
  • Chain 'D':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpwd_
  • Chain 'E':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpwe_
  • Chain 'F':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpwf_
  • Chain 'G':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABF4 (Start-96)
      • expression tag (97-98)
    Domains in SCOPe 2.07: d3mpwg1, d3mpwg2
  • Chain 'H':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpwh_
  • Chain 'I':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpwi_
  • Chain 'J':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpwj_
  • Chain 'K':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpwk_
  • Chain 'L':
    Compound: Ethanolamine utilization protein eutM
    Species: Escherichia coli [TaxId:83333]
    Gene: b2457, cchA, eutM, JW2441, yffZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpwl_
  • Heterogens: PO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mpwA (A:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpwA (A:)
    ealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdagaa
    aaqrigelvsvhviprphgdleevfpiglkgdssnlhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mpwB (B:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpwB (B:)
    ealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdagaa
    aaqrigelvsvhviprphgdleevfpiglkgdssnlh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mpwC (C:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpwC (C:)
    ealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdagaa
    aaqrigelvsvhviprphgdleevfpiglkg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mpwD (D:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpwD (D:)
    ealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdagaa
    aaqrigelvsvhviprphgdleevfpiglkg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3mpwE (E:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpwE (E:)
    ealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdagaa
    aaqrigelvsvhviprphgdleevfpiglk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mpwF (F:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpwF (F:)
    ealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdagaa
    aaqrigelvsvhviprphgdleevfpiglk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mpwG (G:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpwG (G:)
    ealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdagaa
    aaqrigelvsvhviprphgdleevfpiglkgdssnlhh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3mpwH (H:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpwH (H:)
    ealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdagaa
    aaqrigelvsvhviprphgdleevfpiglk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3mpwI (I:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpwI (I:)
    ealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdagaa
    aaqrigelvsvhviprphgdleevfpiglk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3mpwJ (J:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpwJ (J:)
    ealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdagaa
    aaqrigelvsvhviprphgdleevfpiglk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3mpwK (K:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpwK (K:)
    ealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdagaa
    aaqrigelvsvhviprphgdleevfpiglk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3mpwL (L:)
    mealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdaga
    aaaqrigelvsvhviprphgdleevfpiglkgdssnlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpwL (L:)
    ealgmietrglvalieasdamvkaarvklvgvkqiggglctamvrgdvaackaatdagaa
    aaqrigelvsvhviprphgdleevfpiglk