PDB entry 3mpu

View 3mpu on RCSB PDB site
Description: Crystal structure of the C47A/A241C disulfide-linked E. coli Aspartate Transcarbamoylase holoenzyme
Class: transferase
Keywords: aspartate trancarbamoylase, disulfide bond, phosphate, catalysis, product release, ordered-sequential mechanism, TRANSFERASE
Deposited on 2010-04-27, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-01, with a file datestamp of 2010-08-27.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.177
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:83333]
    Gene: b4245, JW4204, pyrB, pyrI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A786 (0-309)
      • engineered mutation (46)
      • engineered mutation (240)
    Domains in SCOPe 2.07: d3mpua1, d3mpua2
  • Chain 'B':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:83333]
    Gene: pyrI, b4244, JW4203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpub1, d3mpub2
  • Chain 'C':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:83333]
    Gene: b4245, JW4204, pyrB, pyrI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A786 (0-309)
      • engineered mutation (46)
      • engineered mutation (240)
    Domains in SCOPe 2.07: d3mpuc1, d3mpuc2
  • Chain 'D':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:83333]
    Gene: pyrI, b4244, JW4203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpud1, d3mpud2
  • Chain 'E':
    Compound: Aspartate carbamoyltransferase catalytic chain
    Species: Escherichia coli [TaxId:83333]
    Gene: b4245, JW4204, pyrB, pyrI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A786 (0-309)
      • engineered mutation (46)
      • engineered mutation (240)
    Domains in SCOPe 2.07: d3mpue1, d3mpue2
  • Chain 'F':
    Compound: Aspartate carbamoyltransferase regulatory chain
    Species: Escherichia coli [TaxId:83333]
    Gene: pyrI, b4244, JW4203
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpuf1, d3mpuf2
  • Heterogens: PO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mpuA (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviasaffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    cnvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mpuB (B:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpuB (B:)
    aikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsedq
    vdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfavrkr
    andialkckycekefshnvvlan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mpuC (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviasaffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    cnvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mpuD (D:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpuD (D:)
    aikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsedq
    vdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfavrkr
    andialkckycekefshnvvlan
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mpuE (E:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviasaffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    cnvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3mpuF (F:)
    mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
    ientflsedqvdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaep
    vsssfavrkrandialkckycekefshnvvlan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpuF (F:)
    aikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientflsedq
    vdqlalyapqatvnridnyevvgksrpslperidnvlvcpnsncishaepvsssfavrkr
    andialkckycekefshnvvlan