PDB entry 3mpt

View 3mpt on RCSB PDB site
Description: Crystal structure of P38 kinase in complex with a pyrrole-2-carboxamide inhibitor
Class: transferase/transferase inhibitor
Keywords: P38, SERINE/THREONINE PROTEIN KINASE, MAP KINASE, Pyrrole-2-Carboxamides, inhibitor, TRANSFERASE-TRANSFERASE INHIBIATOR complex, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-04-27, released 2010-07-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.239
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mpta_
  • Heterogens: 1GK, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mptA (A:)
    mkkghhlhhhgmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglr
    vavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlm
    gadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildf
    glarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhi
    dqlklilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekml
    vldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfv
    pppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mptA (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglhtddemtgyvat
    rwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgae
    llkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalah
    ayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp