PDB entry 3mps

View 3mps on RCSB PDB site
Description: Peroxide Bound Oxidized Rubrerythrin from Pyrococcus furiosus
Class: oxidoreductase
Keywords: Diiron, rubrerythrin, peroxidase, peroxide, oxidized, OXIDOREDUCTASE
Deposited on 2010-04-27, released 2011-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.245
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mpsa1, d3mpsa2
  • Chain 'B':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mpsb1, d3mpsb2
  • Chain 'D':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mpsd1, d3mpsd2
  • Chain 'F':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mpsf1, d3mpsf2
  • Chain 'G':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mpsg1, d3mpsg2
  • Chain 'H':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mpsh1, d3mpsh2
  • Chain 'I':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mpsi1, d3mpsi2
  • Chain 'K':
    Compound: rubrerythrin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3mpsk1, d3mpsk2
  • Heterogens: FE, FEO, PEO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mpsA (A:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mpsB (B:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mpsD (D:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mpsF (F:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mpsG (G:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mpsH (H:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mpsI (I:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mpsK (K:)
    vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
    algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
    rkakekaekgedieikkvyicpicgytavdeapeycpvcgapkekfvvfe