PDB entry 3mpp

View 3mpp on RCSB PDB site
Description: Botulinum Neurotoxin Type G Receptor Binding Domain
Class: toxin
Keywords: beta barrel beta trefoil, TOXIN
Deposited on 2010-04-27, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: botulinum neurotoxin type g
    Species: Clostridium botulinum [TaxId:1491]
    Gene: botG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60393 (0-430)
      • engineered (213-215)
      • engineered (217)
      • expression tag (431-432)
    Domains in SCOPe 2.07: d3mppg1, d3mppg2, d3mppg3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3mppG (G:)
    snailslsyrggrlidssgygatmnvgsdvifndigngqfklnnsensnitahqskfvvy
    dsmfdnfsinfwvrtpkynnndiqtylqneytiiscikndsgwkvsikgnriiwtlidvn
    aksksiffeysikdnisdyinkwfsititndrlgnaniyingslkksekilnldrinssn
    didfklinctdttkfvwikdfnifgrelnateveerykiqsstntlkdfwgnplrydtqy
    ylfnqgmqniyikyfskasmgetaprtnfnnaainyqnlylglrfiikkasnsrninndn
    ivregdyiylnidnisdesyrvyvlvnskeiqtqlflapinddptfydvlqikkyyektt
    yncqilcekdtktfglfgigkfvkdygyvwdtydnyfcisqwylrriseninklrlgcnw
    qfipvdegwtelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mppG (G:)
    snailslsyrggrlidssgygatmnvgsdvifndigngqfklnnsensnitahqdnfsin
    fwvrtpkynnndiqtylqneytiiscikndsgwkvsikgnriiwtlidvnaksksiffey
    sikdnisdyinkwfsititndrlgnaniyingslkksekildrinssndidfklinctdt
    tkfvwikdfnifgrelnateveerykiqsntlkdfwgnplrydtqyylfnqgmqniyiky
    fskasmgetaprtnfnnaainyqnlylglrfiikkasdnivregdyiylnidnisdesyr
    vyvlvnskeiqtqlflapinddptfydvlqikkyyekttyncqilcekdtktfglfgigk
    fvydnyfcisqwylrriseninklrlgcnwqfipvdegwtelq