PDB entry 3mpo

View 3mpo on RCSB PDB site
Description: The crystal structure of a hydrolase from Lactobacillus brevis
Class: hydrolase
Keywords: SGX, PSI, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2010-04-27, released 2010-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-12, with a file datestamp of 2010-05-07.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.229
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Predicted hydrolase of the HAD superfamily
    Species: Lactobacillus brevis [TaxId:387344]
    Gene: HAD, LVIS_0481
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpoa_
  • Chain 'B':
    Compound: Predicted hydrolase of the HAD superfamily
    Species: Lactobacillus brevis [TaxId:387344]
    Gene: HAD, LVIS_0481
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpob_
  • Chain 'C':
    Compound: Predicted hydrolase of the HAD superfamily
    Species: Lactobacillus brevis [TaxId:387344]
    Gene: HAD, LVIS_0481
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpoc_
  • Chain 'D':
    Compound: Predicted hydrolase of the HAD superfamily
    Species: Lactobacillus brevis [TaxId:387344]
    Gene: HAD, LVIS_0481
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3mpod_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mpoA (A:)
    msltikliaididgtllneknelaqatidavqaakaqgikvvlctgrpltgvqpyldamd
    idgddqyaitfngsvaqtisgkvltnhsltyedyidleawarkvrahfqietpdyiytan
    kdisaytiaesylvrmliqyrevsetprdltiskamfvdypqvieqvkanmpqdfkdrfs
    vvqsapyfievmnrraskggtlselvdqlgltaddvmtlgdqgndltmikyaglgvamgn
    aidevkeaaqavtltnaengvaaairkyalneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpoA (A:)
    ikliaidiaqatidavqaakaqgikvvlctgrpltgvqpyldamdidgddqyaitfngsv
    aqtisgkvltnhsltyedyidleawarkvrahfqietpdyiytankdisaytiaesylvr
    mliqyrevsetprdltiskamfvdypqvieqvkanmpqdfkdrfsvvqsapyfievmnrr
    askggtlselvdqlgltaddvmtlqgndltmikyaglgvamidevkeaaqavtgvaaair
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mpoB (B:)
    msltikliaididgtllneknelaqatidavqaakaqgikvvlctgrpltgvqpyldamd
    idgddqyaitfngsvaqtisgkvltnhsltyedyidleawarkvrahfqietpdyiytan
    kdisaytiaesylvrmliqyrevsetprdltiskamfvdypqvieqvkanmpqdfkdrfs
    vvqsapyfievmnrraskggtlselvdqlgltaddvmtlgdqgndltmikyaglgvamgn
    aidevkeaaqavtltnaengvaaairkyalneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpoB (B:)
    tikliaididgtllneknelaqatidavqaakaqgikvvlctgrpltgvqpyldamdidg
    ddqyaitfngsvaqtisgkvltnhsltyedyidleawarkvrahfqietpdyiytankdi
    saytiaesylvrmliqyrevsetprdltiskamfvdypqvieqvkanmpqdfkdrfsvvq
    sapyfievmnrraskggtlselvdqlgltaddvmtlgdqgndltmikyaglgvamgnaid
    evkeaaqavtltnaengvaaairkya
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3mpoC (C:)
    msltikliaididgtllneknelaqatidavqaakaqgikvvlctgrpltgvqpyldamd
    idgddqyaitfngsvaqtisgkvltnhsltyedyidleawarkvrahfqietpdyiytan
    kdisaytiaesylvrmliqyrevsetprdltiskamfvdypqvieqvkanmpqdfkdrfs
    vvqsapyfievmnrraskggtlselvdqlgltaddvmtlgdqgndltmikyaglgvamgn
    aidevkeaaqavtltnaengvaaairkyalneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpoC (C:)
    tikliaididaqatidavqaakaqgikvvlctgrpltgvqpyldamdidgddqyaitfng
    svaqtisgkvltnhsltyedyidleawarkvrahfqietpdyiytankdisaytiaesyl
    vrmliqyrevsetprdltiskamfvdypqvieqvkanmpqdfkdrfsvvqsapyfievmn
    rraskggtlselvdqlgltaddvmtlgdqgndltmikyaglgvamgnaidevkeaaqavt
    ltnaengvaaairkyal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3mpoD (D:)
    msltikliaididgtllneknelaqatidavqaakaqgikvvlctgrpltgvqpyldamd
    idgddqyaitfngsvaqtisgkvltnhsltyedyidleawarkvrahfqietpdyiytan
    kdisaytiaesylvrmliqyrevsetprdltiskamfvdypqvieqvkanmpqdfkdrfs
    vvqsapyfievmnrraskggtlselvdqlgltaddvmtlgdqgndltmikyaglgvamgn
    aidevkeaaqavtltnaengvaaairkyalneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpoD (D:)
    tikliaididgtlqatidavqaakaqgikvvlctgrpltgvqpyldamdidgddqyaitf
    ngsvaqtisgkvltnhsltyedyidleawarkvrahfqietpdyiytankdisaytiaes
    ylvrmliqyrevsetprdltiskamfvdypqvieqvkanmpqdfkdrfsvvqsapyfiev
    mnrraskggtlselvdqlgltaddvmtlgndltmikyaglgvamgnaidevke