PDB entry 3mpn

View 3mpn on RCSB PDB site
Description: F177R1 mutant of LeuT
Class: membrane protein
Keywords: alpha helix, SDSL, spin label, nitroxide, membrane protein
Deposited on 2010-04-27, released 2010-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.175
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transporter
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: snf, aq_2077
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67854 (0-506)
      • engineered (172)
    Domains in SCOPe 2.07: d3mpna_
  • Heterogens: BOG, LEU, MTN, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mpnA (A:)
    rehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiewa
    mgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikflv
    glvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmcinvsili
    rgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvw
    iaavgqifftlslgfgaiityasyvrkdqdivlsgltaatlnekaevilggsisipaava
    ffgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaimqpmi
    afledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiff
    wifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeethwtvw
    itrfyiiglflfltflvflaerrrnhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mpnA (A:)
    rehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiewa
    mgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikflv
    glvpeppptdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmcinvsilirg
    iskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvwia
    avgqifftlslgfgaiityasyvrkdqdivlsgltaatlnekaevilggsisipaavaff
    gvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaimqpmiaf
    ledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiffwi
    fgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeethwtvwit
    rfyiiglflfltflvflaerrrnhe